Protein ID | Hirsu2|10062 |
Gene name | |
Location | Contig_781:1341..2188 |
Strand | + |
Gene length (bp) | 847 |
Transcript length (bp) | 681 |
Coding sequence length (bp) | 681 |
Protein length (aa) | 227 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF14681 | UPRTase | Uracil phosphoribosyltransferase | 5.5E-70 | 10 | 223 |
PF00156 | Pribosyltran | Phosphoribosyl transferase domain | 5.7E-08 | 80 | 176 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q9US43|UPP3_SCHPO | Putative uracil phosphoribosyltransferase urg2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=urg2 PE=3 SV=2 | 6 | 221 | 5.0E-45 |
sp|B0S2A9|UPP_FINM2 | Uracil phosphoribosyltransferase OS=Finegoldia magna (strain ATCC 29328) GN=upp PE=3 SV=1 | 6 | 223 | 9.0E-45 |
sp|A0ALM3|UPP_LISW6 | Uracil phosphoribosyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=upp PE=3 SV=1 | 6 | 223 | 2.0E-44 |
sp|Q8Y4B3|UPP_LISMO | Uracil phosphoribosyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=upp PE=3 SV=1 | 6 | 223 | 2.0E-44 |
sp|B8DBH1|UPP_LISMH | Uracil phosphoribosyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=upp PE=3 SV=1 | 6 | 223 | 2.0E-44 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q9US43|UPP3_SCHPO | Putative uracil phosphoribosyltransferase urg2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=urg2 PE=3 SV=2 | 6 | 221 | 5.0E-45 |
sp|B0S2A9|UPP_FINM2 | Uracil phosphoribosyltransferase OS=Finegoldia magna (strain ATCC 29328) GN=upp PE=3 SV=1 | 6 | 223 | 9.0E-45 |
sp|A0ALM3|UPP_LISW6 | Uracil phosphoribosyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=upp PE=3 SV=1 | 6 | 223 | 2.0E-44 |
sp|Q8Y4B3|UPP_LISMO | Uracil phosphoribosyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=upp PE=3 SV=1 | 6 | 223 | 2.0E-44 |
sp|B8DBH1|UPP_LISMH | Uracil phosphoribosyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=upp PE=3 SV=1 | 6 | 223 | 2.0E-44 |
sp|Q71WP0|UPP_LISMF | Uracil phosphoribosyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=upp PE=3 SV=1 | 6 | 223 | 2.0E-44 |
sp|C1KYV5|UPP_LISMC | Uracil phosphoribosyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=upp PE=3 SV=1 | 6 | 223 | 2.0E-44 |
sp|Q927V5|UPP_LISIN | Uracil phosphoribosyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=upp PE=3 SV=1 | 6 | 223 | 4.0E-44 |
sp|Q6HAX0|UPP_BACHK | Uracil phosphoribosyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-42 |
sp|Q630T4|UPP_BACCZ | Uracil phosphoribosyltransferase OS=Bacillus cereus (strain ZK / E33L) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-42 |
sp|Q814V3|UPP_BACCR | Uracil phosphoribosyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-42 |
sp|B9IRU7|UPP_BACCQ | Uracil phosphoribosyltransferase OS=Bacillus cereus (strain Q1) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-42 |
sp|B7HY75|UPP_BACC7 | Uracil phosphoribosyltransferase OS=Bacillus cereus (strain AH187) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-42 |
sp|B7HFL2|UPP_BACC4 | Uracil phosphoribosyltransferase OS=Bacillus cereus (strain B4264) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-42 |
sp|C1F0N8|UPP_BACC3 | Uracil phosphoribosyltransferase OS=Bacillus cereus (strain 03BB102) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-42 |
sp|B7IQW8|UPP_BACC2 | Uracil phosphoribosyltransferase OS=Bacillus cereus (strain G9842) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-42 |
sp|Q72XD8|UPP_BACC1 | Uracil phosphoribosyltransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-42 |
sp|B7JGP0|UPP_BACC0 | Uracil phosphoribosyltransferase OS=Bacillus cereus (strain AH820) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-42 |
sp|Q81JY5|UPP_BACAN | Uracil phosphoribosyltransferase OS=Bacillus anthracis GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-42 |
sp|C3LFI9|UPP_BACAC | Uracil phosphoribosyltransferase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-42 |
sp|C3P1G4|UPP_BACAA | Uracil phosphoribosyltransferase OS=Bacillus anthracis (strain A0248) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-42 |
sp|A9VSB3|UPP_BACWK | Uracil phosphoribosyltransferase OS=Bacillus weihenstephanensis (strain KBAB4) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-42 |
sp|A0RLA2|UPP_BACAH | Uracil phosphoribosyltransferase OS=Bacillus thuringiensis (strain Al Hakam) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-42 |
sp|B2TJY9|UPP_CLOBB | Uracil phosphoribosyltransferase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-41 |
sp|B2UZI9|UPP_CLOBA | Uracil phosphoribosyltransferase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-41 |
sp|B9E8F4|UPP_MACCJ | Uracil phosphoribosyltransferase OS=Macrococcus caseolyticus (strain JCSC5402) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-41 |
sp|Q24MM7|UPP_DESHY | Uracil phosphoribosyltransferase OS=Desulfitobacterium hafniense (strain Y51) GN=upp PE=3 SV=1 | 6 | 223 | 3.0E-41 |
sp|B8FZ68|UPP_DESHD | Uracil phosphoribosyltransferase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=upp PE=3 SV=1 | 6 | 223 | 3.0E-41 |
sp|B1YEG7|UPP_EXIS2 | Uracil phosphoribosyltransferase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=upp PE=3 SV=1 | 6 | 223 | 4.0E-41 |
sp|Q180X8|UPP_PEPD6 | Uracil phosphoribosyltransferase OS=Peptoclostridium difficile (strain 630) GN=upp PE=3 SV=1 | 6 | 223 | 4.0E-41 |
sp|B1HM47|UPP_LYSSC | Uracil phosphoribosyltransferase OS=Lysinibacillus sphaericus (strain C3-41) GN=upp PE=3 SV=1 | 6 | 223 | 5.0E-41 |
sp|Q5KUI3|UPP_GEOKA | Uracil phosphoribosyltransferase OS=Geobacillus kaustophilus (strain HTA426) GN=upp PE=3 SV=1 | 6 | 223 | 6.0E-41 |
sp|B0K1G2|UPP_THEPX | Uracil phosphoribosyltransferase OS=Thermoanaerobacter sp. (strain X514) GN=upp PE=3 SV=1 | 6 | 223 | 6.0E-41 |
sp|B0K7G1|UPP_THEP3 | Uracil phosphoribosyltransferase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=upp PE=3 SV=1 | 6 | 223 | 6.0E-41 |
sp|Q8RD94|UPP_CALS4 | Uracil phosphoribosyltransferase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=upp PE=3 SV=1 | 6 | 223 | 7.0E-41 |
sp|A3DIL9|UPP_CLOTH | Uracil phosphoribosyltransferase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=upp PE=3 SV=1 | 6 | 223 | 8.0E-41 |
sp|A7GV65|UPP_BACCN | Uracil phosphoribosyltransferase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-40 |
sp|Q8EM74|UPP_OCEIH | Uracil phosphoribosyltransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=upp PE=3 SV=1 | 6 | 223 | 2.0E-40 |
sp|P39149|UPP_BACSU | Uracil phosphoribosyltransferase OS=Bacillus subtilis (strain 168) GN=upp PE=3 SV=1 | 6 | 223 | 5.0E-40 |
sp|C4KYT2|UPP_EXISA | Uracil phosphoribosyltransferase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=upp PE=3 SV=1 | 7 | 223 | 5.0E-40 |
sp|Q65DW6|UPP_BACLD | Uracil phosphoribosyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=upp PE=3 SV=1 | 6 | 223 | 5.0E-40 |
sp|B7GMG3|UPP_ANOFW | Uracil phosphoribosyltransferase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=upp PE=3 SV=1 | 6 | 223 | 6.0E-40 |
sp|Q5WB67|UPP_BACSK | Uracil phosphoribosyltransferase OS=Bacillus clausii (strain KSM-K16) GN=upp PE=3 SV=1 | 6 | 223 | 6.0E-40 |
sp|A5N3J1|UPP_CLOK5 | Uracil phosphoribosyltransferase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=upp PE=3 SV=1 | 6 | 223 | 6.0E-40 |
sp|B9DX75|UPP_CLOK1 | Uracil phosphoribosyltransferase OS=Clostridium kluyveri (strain NBRC 12016) GN=upp PE=3 SV=1 | 6 | 223 | 6.0E-40 |
sp|Q9K6G5|UPP_BACHD | Uracil phosphoribosyltransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=upp PE=3 SV=1 | 6 | 223 | 9.0E-40 |
sp|C5D9M4|UPP_GEOSW | Uracil phosphoribosyltransferase OS=Geobacillus sp. (strain WCH70) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-39 |
sp|Q04DP1|UPP_OENOB | Uracil phosphoribosyltransferase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-39 |
sp|Q8CRN4|UPP_STAES | Uracil phosphoribosyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=upp PE=3 SV=1 | 6 | 223 | 2.0E-39 |
sp|Q5HMB1|UPP_STAEQ | Uracil phosphoribosyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=upp PE=3 SV=1 | 6 | 223 | 2.0E-39 |
sp|B2A3H5|UPP_NATTJ | Uracil phosphoribosyltransferase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=upp PE=3 SV=1 | 6 | 223 | 2.0E-39 |
sp|Q5SIQ7|UPP_THET8 | Uracil phosphoribosyltransferase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=upp PE=3 SV=1 | 13 | 223 | 2.0E-39 |
sp|Q72J35|UPP_THET2 | Uracil phosphoribosyltransferase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=upp PE=1 SV=1 | 13 | 223 | 2.0E-39 |
sp|P70881|UPP_BACCL | Uracil phosphoribosyltransferase OS=Bacillus caldolyticus GN=upp PE=1 SV=2 | 6 | 223 | 3.0E-39 |
sp|A7Z9Q8|UPP_BACMF | Uracil phosphoribosyltransferase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=upp PE=3 SV=1 | 7 | 223 | 5.0E-39 |
sp|B1KSR7|UPP_CLOBM | Uracil phosphoribosyltransferase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=upp PE=3 SV=1 | 6 | 223 | 5.0E-39 |
sp|A7G9P8|UPP_CLOBL | Uracil phosphoribosyltransferase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=upp PE=3 SV=1 | 6 | 223 | 5.0E-39 |
sp|B1IE69|UPP_CLOBK | Uracil phosphoribosyltransferase OS=Clostridium botulinum (strain Okra / Type B1) GN=upp PE=3 SV=1 | 6 | 223 | 5.0E-39 |
sp|C1FQA3|UPP_CLOBJ | Uracil phosphoribosyltransferase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=upp PE=3 SV=1 | 6 | 223 | 5.0E-39 |
sp|A5HY41|UPP_CLOBH | Uracil phosphoribosyltransferase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=upp PE=3 SV=1 | 6 | 223 | 5.0E-39 |
sp|C3KYI1|UPP_CLOB6 | Uracil phosphoribosyltransferase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=upp PE=3 SV=1 | 6 | 223 | 5.0E-39 |
sp|A7FQG8|UPP_CLOB1 | Uracil phosphoribosyltransferase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=upp PE=3 SV=1 | 6 | 223 | 5.0E-39 |
sp|A8FIC0|UPP_BACP2 | Uracil phosphoribosyltransferase OS=Bacillus pumilus (strain SAFR-032) GN=upp PE=3 SV=1 | 6 | 223 | 7.0E-39 |
sp|Q4L7Z3|UPP_STAHJ | Uracil phosphoribosyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=upp PE=3 SV=1 | 6 | 223 | 9.0E-39 |
sp|Q831G0|UPP_ENTFA | Uracil phosphoribosyltransferase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=upp PE=3 SV=1 | 7 | 223 | 9.0E-39 |
sp|P67397|UPP_STAAW | Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain MW2) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-38 |
sp|A8YY79|UPP_STAAT | Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-38 |
sp|Q6G7J8|UPP_STAAS | Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-38 |
sp|Q6GEW3|UPP_STAAR | Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-38 |
sp|P67396|UPP_STAAN | Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain N315) GN=upp PE=1 SV=1 | 6 | 223 | 1.0E-38 |
sp|P67395|UPP_STAAM | Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-38 |
sp|A6QIV6|UPP_STAAE | Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain Newman) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-38 |
sp|Q5HE88|UPP_STAAC | Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain COL) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-38 |
sp|Q2YUJ2|UPP_STAAB | Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-38 |
sp|A5IUQ7|UPP_STAA9 | Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain JH9) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-38 |
sp|Q2FWE6|UPP_STAA8 | Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain NCTC 8325) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-38 |
sp|Q2FF16|UPP_STAA3 | Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain USA300) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-38 |
sp|A6U3J7|UPP_STAA2 | Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain JH1) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-38 |
sp|A7X4V6|UPP_STAA1 | Uracil phosphoribosyltransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-38 |
sp|B8I567|UPP_CLOCE | Uracil phosphoribosyltransferase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=upp PE=3 SV=1 | 6 | 223 | 2.0E-38 |
sp|Q898X9|UPP_CLOTE | Uracil phosphoribosyltransferase OS=Clostridium tetani (strain Massachusetts / E88) GN=upp PE=3 SV=1 | 6 | 223 | 2.0E-38 |
sp|B9DMF2|UPP_STACT | Uracil phosphoribosyltransferase OS=Staphylococcus carnosus (strain TM300) GN=upp PE=3 SV=1 | 7 | 223 | 3.0E-38 |
sp|A6TK51|UPP_ALKMQ | Uracil phosphoribosyltransferase OS=Alkaliphilus metalliredigens (strain QYMF) GN=upp PE=3 SV=1 | 6 | 223 | 4.0E-38 |
sp|B5YDB8|UPP_DICT6 | Uracil phosphoribosyltransferase OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=upp PE=3 SV=1 | 8 | 223 | 5.0E-38 |
sp|Q9WZI0|UPP_THEMA | Uracil phosphoribosyltransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=upp PE=1 SV=1 | 6 | 223 | 6.0E-38 |
sp|C0Z818|UPP_BREBN | Uracil phosphoribosyltransferase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=upp PE=3 SV=1 | 6 | 223 | 8.0E-38 |
sp|Q2ST42|UPP_MYCCT | Uracil phosphoribosyltransferase OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=upp PE=3 SV=1 | 12 | 223 | 9.0E-38 |
sp|A4VWM9|UPP_STRSY | Uracil phosphoribosyltransferase OS=Streptococcus suis (strain 05ZYH33) GN=upp PE=3 SV=1 | 7 | 223 | 9.0E-38 |
sp|Q0SQY5|UPP_CLOPS | Uracil phosphoribosyltransferase OS=Clostridium perfringens (strain SM101 / Type A) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-37 |
sp|B1L7Y5|UPP_THESQ | Uracil phosphoribosyltransferase OS=Thermotoga sp. (strain RQ2) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-37 |
sp|A5IJ64|UPP_THEP1 | Uracil phosphoribosyltransferase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-37 |
sp|A9KIB0|UPP_CLOPH | Uracil phosphoribosyltransferase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-37 |
sp|Q6MS86|UPP_MYCMS | Uracil phosphoribosyltransferase OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=upp PE=3 SV=2 | 12 | 223 | 1.0E-37 |
sp|Q67TC9|UPP_SYMTH | Uracil phosphoribosyltransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-37 |
sp|B0TI63|UPP_HELMI | Uracil phosphoribosyltransferase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=upp PE=3 SV=1 | 6 | 223 | 2.0E-37 |
sp|P36399|UPP_STRSL | Uracil phosphoribosyltransferase OS=Streptococcus salivarius GN=upp PE=3 SV=1 | 7 | 223 | 2.0E-37 |
sp|Q8XIC4|UPP_CLOPE | Uracil phosphoribosyltransferase OS=Clostridium perfringens (strain 13 / Type A) GN=upp PE=3 SV=1 | 6 | 223 | 3.0E-37 |
sp|Q0TNB4|UPP_CLOP1 | Uracil phosphoribosyltransferase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=upp PE=3 SV=1 | 6 | 223 | 3.0E-37 |
sp|C4Z9S1|UPP_EUBR3 | Uracil phosphoribosyltransferase OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=upp PE=3 SV=1 | 6 | 223 | 6.0E-37 |
sp|A7NRA6|UPP_ROSCS | Uracil phosphoribosyltransferase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=upp PE=3 SV=1 | 6 | 223 | 6.0E-37 |
sp|Q97F73|UPP_CLOAB | Uracil phosphoribosyltransferase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=upp PE=3 SV=1 | 6 | 223 | 8.0E-37 |
sp|A0RR59|UPP_CAMFF | Uracil phosphoribosyltransferase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=upp PE=3 SV=1 | 6 | 224 | 8.0E-37 |
sp|A5UQV0|UPP_ROSS1 | Uracil phosphoribosyltransferase OS=Roseiflexus sp. (strain RS-1) GN=upp PE=3 SV=1 | 6 | 223 | 9.0E-37 |
sp|A8MJX1|UPP_ALKOO | Uracil phosphoribosyltransferase OS=Alkaliphilus oremlandii (strain OhILAs) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-36 |
sp|Q8DST6|UPP_STRMU | Uracil phosphoribosyltransferase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=upp PE=3 SV=1 | 7 | 223 | 1.0E-36 |
sp|A6LQG6|UPP_CLOB8 | Uracil phosphoribosyltransferase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-36 |
sp|C0MGT4|UPP_STRS7 | Uracil phosphoribosyltransferase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=upp PE=3 SV=1 | 9 | 223 | 1.0E-36 |
sp|B4U4M9|UPP_STREM | Uracil phosphoribosyltransferase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=upp PE=3 SV=1 | 9 | 223 | 1.0E-36 |
sp|C0M7M9|UPP_STRE4 | Uracil phosphoribosyltransferase OS=Streptococcus equi subsp. equi (strain 4047) GN=upp PE=3 SV=1 | 9 | 223 | 1.0E-36 |
sp|Q03M79|UPP_STRTD | Uracil phosphoribosyltransferase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=upp PE=3 SV=1 | 7 | 223 | 1.0E-36 |
sp|Q5M5U5|UPP_STRT2 | Uracil phosphoribosyltransferase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=upp PE=3 SV=1 | 7 | 223 | 1.0E-36 |
sp|Q5M1A9|UPP_STRT1 | Uracil phosphoribosyltransferase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=upp PE=3 SV=1 | 7 | 223 | 1.0E-36 |
sp|B8E009|UPP_DICTD | Uracil phosphoribosyltransferase OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=upp PE=3 SV=1 | 8 | 223 | 2.0E-36 |
sp|Q8DQI3|UPP_STRR6 | Uracil phosphoribosyltransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=upp PE=3 SV=2 | 7 | 223 | 5.0E-36 |
sp|Q03EK5|UPP_PEDPA | Uracil phosphoribosyltransferase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=upp PE=3 SV=1 | 7 | 223 | 5.0E-36 |
sp|Q6AQH2|UPP_DESPS | Uracil phosphoribosyltransferase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=upp PE=3 SV=1 | 7 | 223 | 6.0E-36 |
sp|Q03QY1|UPP_LACBA | Uracil phosphoribosyltransferase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=upp PE=3 SV=1 | 7 | 223 | 6.0E-36 |
sp|A6LMU0|UPP_THEM4 | Uracil phosphoribosyltransferase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=upp PE=3 SV=1 | 7 | 223 | 6.0E-36 |
sp|A7ZFB7|UPP_CAMC1 | Uracil phosphoribosyltransferase OS=Campylobacter concisus (strain 13826) GN=upp PE=3 SV=1 | 6 | 224 | 7.0E-36 |
sp|A9NEQ2|UPP_ACHLI | Uracil phosphoribosyltransferase OS=Acholeplasma laidlawii (strain PG-8A) GN=upp PE=3 SV=1 | 10 | 223 | 7.0E-36 |
sp|B7IDR9|UPP_THEAB | Uracil phosphoribosyltransferase OS=Thermosipho africanus (strain TCF52B) GN=upp PE=3 SV=1 | 7 | 223 | 8.0E-36 |
sp|Q8RG35|UPP_FUSNN | Uracil phosphoribosyltransferase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=upp PE=3 SV=2 | 12 | 223 | 1.0E-35 |
sp|B9DTU7|UPP_STRU0 | Uracil phosphoribosyltransferase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=upp PE=3 SV=1 | 9 | 223 | 1.0E-35 |
sp|Q97RQ3|UPP_STRPN | Uracil phosphoribosyltransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=upp PE=3 SV=1 | 7 | 223 | 1.0E-35 |
sp|A0Q306|UPP_CLONN | Uracil phosphoribosyltransferase OS=Clostridium novyi (strain NT) GN=upp PE=3 SV=1 | 13 | 223 | 2.0E-35 |
sp|Q042K8|UPP_LACGA | Uracil phosphoribosyltransferase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=upp PE=3 SV=1 | 10 | 223 | 2.0E-35 |
sp|Q04BB0|UPP_LACDB | Uracil phosphoribosyltransferase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=upp PE=3 SV=1 | 10 | 223 | 3.0E-35 |
sp|Q1GAX2|UPP_LACDA | Uracil phosphoribosyltransferase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=upp PE=3 SV=1 | 10 | 223 | 3.0E-35 |
sp|Q9RE01|UPP_LACPL | Uracil phosphoribosyltransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=upp PE=3 SV=1 | 7 | 223 | 3.0E-35 |
sp|B9KAQ6|UPP_THENN | Uracil phosphoribosyltransferase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=upp PE=3 SV=1 | 6 | 223 | 3.0E-35 |
sp|Q49Z59|UPP_STAS1 | Uracil phosphoribosyltransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=upp PE=3 SV=1 | 7 | 223 | 4.0E-35 |
sp|P0DH35|UPP_STRPQ | Uracil phosphoribosyltransferase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=upp PE=3 SV=1 | 9 | 223 | 4.0E-35 |
sp|Q48V26|UPP_STRPM | Uracil phosphoribosyltransferase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=upp PE=3 SV=1 | 9 | 223 | 4.0E-35 |
sp|A2RG73|UPP_STRPG | Uracil phosphoribosyltransferase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=upp PE=3 SV=1 | 9 | 223 | 4.0E-35 |
sp|Q1J888|UPP_STRPF | Uracil phosphoribosyltransferase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=upp PE=3 SV=1 | 9 | 223 | 4.0E-35 |
sp|Q1JID6|UPP_STRPD | Uracil phosphoribosyltransferase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=upp PE=3 SV=1 | 9 | 223 | 4.0E-35 |
sp|Q1JN85|UPP_STRPC | Uracil phosphoribosyltransferase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=upp PE=3 SV=1 | 9 | 223 | 4.0E-35 |
sp|P67402|UPP_STRP8 | Uracil phosphoribosyltransferase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=upp PE=3 SV=1 | 9 | 223 | 4.0E-35 |
sp|Q5XDM5|UPP_STRP6 | Uracil phosphoribosyltransferase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=upp PE=3 SV=1 | 9 | 223 | 4.0E-35 |
sp|P0DH34|UPP_STRP3 | Uracil phosphoribosyltransferase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=upp PE=3 SV=1 | 9 | 223 | 4.0E-35 |
sp|P67400|UPP_STRP1 | Uracil phosphoribosyltransferase OS=Streptococcus pyogenes serotype M1 GN=upp PE=3 SV=1 | 9 | 223 | 4.0E-35 |
sp|P50926|UPP_LACLM | Uracil phosphoribosyltransferase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=upp PE=3 SV=1 | 6 | 223 | 4.0E-35 |
sp|Q9CEC9|UPP_LACLA | Uracil phosphoribosyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=upp PE=3 SV=1 | 6 | 223 | 4.0E-35 |
sp|A1W0S0|UPP_CAMJJ | Uracil phosphoribosyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=upp PE=3 SV=1 | 6 | 224 | 6.0E-35 |
sp|A8FMZ1|UPP_CAMJ8 | Uracil phosphoribosyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=upp PE=3 SV=1 | 6 | 224 | 6.0E-35 |
sp|A7H0F9|UPP_CAMC5 | Uracil phosphoribosyltransferase OS=Campylobacter curvus (strain 525.92) GN=upp PE=3 SV=1 | 6 | 224 | 7.0E-35 |
sp|Q38WJ8|UPP_LACSS | Uracil phosphoribosyltransferase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=upp PE=3 SV=1 | 10 | 223 | 8.0E-35 |
sp|Q93CX7|UPP_LACSK | Uracil phosphoribosyltransferase OS=Lactobacillus sakei GN=upp PE=3 SV=1 | 10 | 223 | 8.0E-35 |
sp|B5XJZ7|UPP_STRPZ | Uracil phosphoribosyltransferase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=upp PE=3 SV=1 | 9 | 221 | 8.0E-35 |
sp|Q9PN13|UPP_CAMJE | Uracil phosphoribosyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=upp PE=3 SV=1 | 6 | 224 | 9.0E-35 |
sp|Q02WM7|UPP_LACLS | Uracil phosphoribosyltransferase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-34 |
sp|B2GAT5|UPP_LACF3 | Uracil phosphoribosyltransferase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-34 |
sp|P67399|UPP_STRA5 | Uracil phosphoribosyltransferase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=upp PE=3 SV=1 | 7 | 223 | 2.0E-34 |
sp|P67398|UPP_STRA3 | Uracil phosphoribosyltransferase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=upp PE=3 SV=1 | 7 | 223 | 2.0E-34 |
sp|Q3JZU9|UPP_STRA1 | Uracil phosphoribosyltransferase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=upp PE=3 SV=1 | 7 | 223 | 2.0E-34 |
sp|Q1WUD3|UPP_LACS1 | Uracil phosphoribosyltransferase OS=Lactobacillus salivarius (strain UCC118) GN=upp PE=3 SV=1 | 7 | 223 | 4.0E-34 |
sp|C4XJX5|UPP_DESMR | Uracil phosphoribosyltransferase OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=upp PE=3 SV=1 | 8 | 223 | 4.0E-34 |
sp|Q6F210|UPP_MESFL | Uracil phosphoribosyltransferase OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=upp PE=3 SV=1 | 12 | 223 | 6.0E-34 |
sp|B5ZAU8|UPP_UREU1 | Uracil phosphoribosyltransferase OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=upp PE=3 SV=1 | 10 | 223 | 6.0E-34 |
sp|Q5HTC1|UPP_CAMJR | Uracil phosphoribosyltransferase OS=Campylobacter jejuni (strain RM1221) GN=upp PE=3 SV=1 | 6 | 224 | 7.0E-34 |
sp|B8IZH6|UPP_DESDA | Uracil phosphoribosyltransferase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=upp PE=3 SV=1 | 8 | 223 | 9.0E-34 |
sp|Q9PR28|UPP_UREPA | Uracil phosphoribosyltransferase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=upp PE=3 SV=1 | 10 | 223 | 1.0E-33 |
sp|B1AIA5|UPP_UREP2 | Uracil phosphoribosyltransferase OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=upp PE=3 SV=1 | 10 | 223 | 1.0E-33 |
sp|Q7M8H6|UPP_WOLSU | Uracil phosphoribosyltransferase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=upp PE=3 SV=1 | 12 | 223 | 1.0E-33 |
sp|B3WDL1|UPP_LACCB | Uracil phosphoribosyltransferase OS=Lactobacillus casei (strain BL23) GN=upp PE=3 SV=1 | 10 | 223 | 1.0E-33 |
sp|Q03A25|UPP_LACC3 | Uracil phosphoribosyltransferase OS=Lactobacillus casei (strain ATCC 334) GN=upp PE=3 SV=1 | 10 | 223 | 1.0E-33 |
sp|A3CPK9|UPP_STRSV | Uracil phosphoribosyltransferase OS=Streptococcus sanguinis (strain SK36) GN=upp PE=3 SV=1 | 7 | 223 | 2.0E-33 |
sp|A8AYQ0|UPP_STRGC | Uracil phosphoribosyltransferase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=upp PE=3 SV=1 | 7 | 223 | 3.0E-33 |
sp|Q3IC38|UPP_PSEHT | Uracil phosphoribosyltransferase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=upp PE=3 SV=1 | 8 | 224 | 3.0E-33 |
sp|Q9RU32|UPP_DEIRA | Uracil phosphoribosyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=upp PE=3 SV=1 | 8 | 223 | 4.0E-33 |
sp|Q9RGY8|UPP_LACAC | Uracil phosphoribosyltransferase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=upp PE=3 SV=2 | 13 | 223 | 5.0E-33 |
sp|A6WYH9|UPP_OCHA4 | Uracil phosphoribosyltransferase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=upp PE=3 SV=1 | 8 | 221 | 5.0E-33 |
sp|Q6KHA6|UPP_MYCMO | Uracil phosphoribosyltransferase OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=upp PE=3 SV=1 | 8 | 223 | 7.0E-33 |
sp|Q9A627|UPP_CAUCR | Uracil phosphoribosyltransferase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=upp PE=3 SV=1 | 6 | 223 | 8.0E-33 |
sp|B8GYP3|UPP_CAUCN | Uracil phosphoribosyltransferase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=upp PE=3 SV=1 | 6 | 223 | 8.0E-33 |
sp|B2G680|UPP_LACRJ | Uracil phosphoribosyltransferase OS=Lactobacillus reuteri (strain JCM 1112) GN=upp PE=3 SV=1 | 6 | 223 | 2.0E-32 |
sp|A5VIQ0|UPP_LACRD | Uracil phosphoribosyltransferase OS=Lactobacillus reuteri (strain DSM 20016) GN=upp PE=3 SV=1 | 6 | 223 | 2.0E-32 |
sp|A8YUJ4|UPP_LACH4 | Uracil phosphoribosyltransferase OS=Lactobacillus helveticus (strain DPC 4571) GN=upp PE=3 SV=1 | 13 | 223 | 2.0E-32 |
sp|P43049|UPP_MYCHO | Uracil phosphoribosyltransferase OS=Mycoplasma hominis GN=upp PE=3 SV=1 | 8 | 223 | 2.0E-32 |
sp|C0QHT9|UPP_DESAH | Uracil phosphoribosyltransferase OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=upp PE=3 SV=1 | 8 | 223 | 3.0E-32 |
sp|Q8EUA1|UPP_MYCPE | Uracil phosphoribosyltransferase OS=Mycoplasma penetrans (strain HF-2) GN=upp PE=3 SV=1 | 9 | 223 | 3.0E-32 |
sp|B3E677|UPP_GEOLS | Uracil phosphoribosyltransferase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=upp PE=3 SV=1 | 8 | 223 | 3.0E-32 |
sp|A5VVW9|UPP_BRUO2 | Uracil phosphoribosyltransferase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=upp PE=3 SV=1 | 8 | 221 | 3.0E-32 |
sp|A7HJR3|UPP_FERNB | Uracil phosphoribosyltransferase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=upp PE=3 SV=1 | 8 | 223 | 4.0E-32 |
sp|Q8FUZ2|UPP_BRUSU | Uracil phosphoribosyltransferase OS=Brucella suis biovar 1 (strain 1330) GN=upp PE=3 SV=2 | 8 | 221 | 4.0E-32 |
sp|A9WW75|UPP_BRUSI | Uracil phosphoribosyltransferase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=upp PE=3 SV=1 | 8 | 221 | 4.0E-32 |
sp|A9MCZ3|UPP_BRUC2 | Uracil phosphoribosyltransferase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=upp PE=3 SV=1 | 8 | 221 | 4.0E-32 |
sp|Q2S320|UPP_SALRD | Uracil phosphoribosyltransferase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=upp PE=3 SV=1 | 6 | 223 | 5.0E-32 |
sp|Q1QVR2|UPP_CHRSD | Uracil phosphoribosyltransferase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=upp PE=3 SV=1 | 7 | 223 | 1.0E-31 |
sp|B2FLX2|UPP_STRMK | Uracil phosphoribosyltransferase OS=Stenotrophomonas maltophilia (strain K279a) GN=upp PE=3 SV=1 | 12 | 223 | 4.0E-31 |
sp|A1AMK6|UPP_PELPD | Uracil phosphoribosyltransferase OS=Pelobacter propionicus (strain DSM 2379) GN=upp PE=3 SV=1 | 12 | 223 | 5.0E-31 |
sp|B4SS22|UPP_STRM5 | Uracil phosphoribosyltransferase OS=Stenotrophomonas maltophilia (strain R551-3) GN=upp PE=3 SV=1 | 12 | 223 | 7.0E-31 |
sp|Q8YDE5|UPP_BRUME | Uracil phosphoribosyltransferase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=upp PE=3 SV=1 | 8 | 221 | 7.0E-31 |
sp|C0RMK4|UPP_BRUMB | Uracil phosphoribosyltransferase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=upp PE=3 SV=1 | 8 | 221 | 7.0E-31 |
sp|Q7NBH2|UPP_MYCGA | Uracil phosphoribosyltransferase OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=upp PE=3 SV=2 | 10 | 223 | 9.0E-31 |
sp|C6BSG3|UPP_DESAD | Uracil phosphoribosyltransferase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=upp PE=3 SV=1 | 8 | 223 | 1.0E-30 |
sp|Q47W53|UPP_COLP3 | Uracil phosphoribosyltransferase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=upp PE=3 SV=1 | 12 | 223 | 1.0E-30 |
sp|Q0SK44|UPP_RHOJR | Uracil phosphoribosyltransferase OS=Rhodococcus jostii (strain RHA1) GN=upp PE=3 SV=1 | 6 | 223 | 2.0E-30 |
sp|Q576P9|UPP_BRUAB | Uracil phosphoribosyltransferase OS=Brucella abortus biovar 1 (strain 9-941) GN=upp PE=3 SV=1 | 8 | 221 | 3.0E-30 |
sp|B2SC51|UPP_BRUA1 | Uracil phosphoribosyltransferase OS=Brucella abortus (strain S19) GN=upp PE=3 SV=1 | 8 | 221 | 3.0E-30 |
sp|Q87MH1|UPP_VIBPA | Uracil phosphoribosyltransferase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=upp PE=3 SV=1 | 12 | 223 | 4.0E-30 |
sp|B8F5N2|UPP_HAEPS | Uracil phosphoribosyltransferase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=upp PE=3 SV=1 | 12 | 223 | 5.0E-30 |
sp|B3PM96|UPP_MYCA5 | Uracil phosphoribosyltransferase OS=Mycoplasma arthritidis (strain 158L3-1) GN=upp PE=3 SV=1 | 12 | 226 | 7.0E-30 |
sp|Q6FE58|UPP_ACIAD | Uracil phosphoribosyltransferase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=upp PE=3 SV=2 | 12 | 226 | 7.0E-30 |
sp|Q7MIK2|UPP_VIBVY | Uracil phosphoribosyltransferase OS=Vibrio vulnificus (strain YJ016) GN=upp PE=3 SV=2 | 12 | 223 | 8.0E-30 |
sp|C3LPM9|UPP_VIBCM | Uracil phosphoribosyltransferase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=upp PE=3 SV=1 | 12 | 223 | 8.0E-30 |
sp|A5F642|UPP_VIBC3 | Uracil phosphoribosyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=upp PE=3 SV=1 | 12 | 223 | 8.0E-30 |
sp|P59001|UPP_XANAC | Uracil phosphoribosyltransferase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=upp PE=3 SV=1 | 12 | 223 | 1.0E-29 |
sp|B5FGY4|UPP_VIBFM | Uracil phosphoribosyltransferase OS=Vibrio fischeri (strain MJ11) GN=upp PE=3 SV=1 | 12 | 223 | 1.0E-29 |
sp|Q1MMV8|UPP_RHIL3 | Uracil phosphoribosyltransferase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=upp PE=3 SV=1 | 8 | 223 | 1.0E-29 |
sp|Q2P2V7|UPP_XANOM | Uracil phosphoribosyltransferase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=upp PE=3 SV=1 | 7 | 223 | 1.0E-29 |
sp|Q65RC3|UPP_MANSM | Uracil phosphoribosyltransferase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=upp PE=3 SV=1 | 12 | 223 | 1.0E-29 |
sp|Q3BS29|UPP_XANC5 | Uracil phosphoribosyltransferase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=upp PE=3 SV=1 | 12 | 223 | 2.0E-29 |
sp|Q7VM34|UPP_HAEDU | Uracil phosphoribosyltransferase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=upp PE=3 SV=1 | 12 | 223 | 2.0E-29 |
sp|B3PXN0|UPP_RHIE6 | Uracil phosphoribosyltransferase OS=Rhizobium etli (strain CIAT 652) GN=upp PE=3 SV=1 | 8 | 223 | 2.0E-29 |
sp|Q6LN74|UPP_PHOPR | Uracil phosphoribosyltransferase OS=Photobacterium profundum GN=upp PE=3 SV=1 | 12 | 223 | 2.0E-29 |
sp|A1B467|UPP_PARDP | Uracil phosphoribosyltransferase OS=Paracoccus denitrificans (strain Pd 1222) GN=upp PE=3 SV=1 | 6 | 221 | 3.0E-29 |
sp|Q9RBJ3|UPP_XANCP | Uracil phosphoribosyltransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=upp PE=3 SV=2 | 12 | 223 | 3.0E-29 |
sp|B0RRQ3|UPP_XANCB | Uracil phosphoribosyltransferase OS=Xanthomonas campestris pv. campestris (strain B100) GN=upp PE=3 SV=1 | 12 | 223 | 3.0E-29 |
sp|Q4UVY0|UPP_XANC8 | Uracil phosphoribosyltransferase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=upp PE=3 SV=1 | 12 | 223 | 3.0E-29 |
sp|B6EJU2|UPP_ALISL | Uracil phosphoribosyltransferase OS=Aliivibrio salmonicida (strain LFI1238) GN=upp PE=3 SV=1 | 12 | 223 | 3.0E-29 |
sp|B8DP34|UPP_DESVM | Uracil phosphoribosyltransferase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=upp PE=3 SV=1 | 8 | 223 | 4.0E-29 |
sp|Q98QP6|UPP_MYCPU | Uracil phosphoribosyltransferase OS=Mycoplasma pulmonis (strain UAB CTIP) GN=upp PE=3 SV=1 | 8 | 223 | 4.0E-29 |
sp|Q9KPY7|UPP_VIBCH | Uracil phosphoribosyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=upp PE=3 SV=1 | 12 | 223 | 4.0E-29 |
sp|A6VQ76|UPP_ACTSZ | Uracil phosphoribosyltransferase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=upp PE=3 SV=1 | 12 | 223 | 4.0E-29 |
sp|Q5WUK0|UPP_LEGPL | Uracil phosphoribosyltransferase OS=Legionella pneumophila (strain Lens) GN=upp PE=3 SV=1 | 6 | 223 | 5.0E-29 |
sp|Q5X340|UPP_LEGPA | Uracil phosphoribosyltransferase OS=Legionella pneumophila (strain Paris) GN=upp PE=3 SV=1 | 6 | 223 | 5.0E-29 |
sp|B9MJ16|UPP_ACIET | Uracil phosphoribosyltransferase OS=Acidovorax ebreus (strain TPSY) GN=upp PE=3 SV=1 | 6 | 223 | 5.0E-29 |
sp|Q98GV3|UPP_RHILO | Uracil phosphoribosyltransferase OS=Rhizobium loti (strain MAFF303099) GN=upp PE=3 SV=1 | 6 | 223 | 5.0E-29 |
sp|B0BTQ3|UPP_ACTPJ | Uracil phosphoribosyltransferase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=upp PE=3 SV=1 | 12 | 223 | 5.0E-29 |
sp|B3H0R2|UPP_ACTP7 | Uracil phosphoribosyltransferase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=upp PE=3 SV=1 | 12 | 223 | 5.0E-29 |
sp|A3MZB6|UPP_ACTP2 | Uracil phosphoribosyltransferase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=upp PE=3 SV=1 | 12 | 223 | 5.0E-29 |
sp|C3MBH2|UPP_RHISN | Uracil phosphoribosyltransferase OS=Rhizobium sp. (strain NGR234) GN=upp PE=3 SV=1 | 8 | 223 | 6.0E-29 |
sp|Q9PJJ6|UPP_CHLMU | Uracil phosphoribosyltransferase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=upp PE=3 SV=1 | 8 | 220 | 6.0E-29 |
sp|A1W748|UPP_ACISJ | Uracil phosphoribosyltransferase OS=Acidovorax sp. (strain JS42) GN=upp PE=3 SV=1 | 6 | 223 | 6.0E-29 |
sp|Q5MZF4|UPP_SYNP6 | Uracil phosphoribosyltransferase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=upp PE=3 SV=1 | 7 | 221 | 7.0E-29 |
sp|Q31MH4|UPP_SYNE7 | Uracil phosphoribosyltransferase OS=Synechococcus elongatus (strain PCC 7942) GN=upp PE=3 SV=1 | 7 | 221 | 7.0E-29 |
sp|C5CLM9|UPP_VARPS | Uracil phosphoribosyltransferase OS=Variovorax paradoxus (strain S110) GN=upp PE=3 SV=1 | 6 | 223 | 8.0E-29 |
sp|A1VEW8|UPP_DESVV | Uracil phosphoribosyltransferase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=upp PE=3 SV=1 | 8 | 223 | 8.0E-29 |
sp|Q72DA4|UPP_DESVH | Uracil phosphoribosyltransferase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=upp PE=3 SV=1 | 8 | 223 | 8.0E-29 |
sp|B5ZXI2|UPP_RHILW | Uracil phosphoribosyltransferase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=upp PE=3 SV=1 | 8 | 223 | 9.0E-29 |
sp|Q9CPL8|UPP_PASMU | Uracil phosphoribosyltransferase OS=Pasteurella multocida (strain Pm70) GN=upp PE=3 SV=1 | 12 | 223 | 1.0E-28 |
sp|Q5ZTB9|UPP_LEGPH | Uracil phosphoribosyltransferase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-28 |
sp|A5IE48|UPP_LEGPC | Uracil phosphoribosyltransferase OS=Legionella pneumophila (strain Corby) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-28 |
sp|C6DZH8|UPP_GEOSM | Uracil phosphoribosyltransferase OS=Geobacter sp. (strain M21) GN=upp PE=3 SV=1 | 7 | 223 | 2.0E-28 |
sp|C1DC78|UPP_LARHH | Uracil phosphoribosyltransferase OS=Laribacter hongkongensis (strain HLHK9) GN=upp PE=3 SV=1 | 7 | 223 | 2.0E-28 |
sp|Q4QJV5|UPP_HAEI8 | Uracil phosphoribosyltransferase OS=Haemophilus influenzae (strain 86-028NP) GN=upp PE=3 SV=1 | 12 | 223 | 2.0E-28 |
sp|C1ARF7|UPP_RHOOB | Uracil phosphoribosyltransferase OS=Rhodococcus opacus (strain B4) GN=upp PE=3 SV=1 | 6 | 223 | 3.0E-28 |
sp|A3M2R1|UPP_ACIBT | Uracil phosphoribosyltransferase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=upp PE=3 SV=2 | 12 | 226 | 3.0E-28 |
sp|B0V8B1|UPP_ACIBY | Uracil phosphoribosyltransferase OS=Acinetobacter baumannii (strain AYE) GN=upp PE=3 SV=1 | 12 | 226 | 3.0E-28 |
sp|B0VU43|UPP_ACIBS | Uracil phosphoribosyltransferase OS=Acinetobacter baumannii (strain SDF) GN=upp PE=3 SV=1 | 12 | 226 | 3.0E-28 |
sp|B2HU54|UPP_ACIBC | Uracil phosphoribosyltransferase OS=Acinetobacter baumannii (strain ACICU) GN=upp PE=3 SV=1 | 12 | 226 | 3.0E-28 |
sp|B7I752|UPP_ACIB5 | Uracil phosphoribosyltransferase OS=Acinetobacter baumannii (strain AB0057) GN=upp PE=3 SV=1 | 12 | 226 | 3.0E-28 |
sp|B7GZA8|UPP_ACIB3 | Uracil phosphoribosyltransferase OS=Acinetobacter baumannii (strain AB307-0294) GN=upp PE=3 SV=1 | 12 | 226 | 3.0E-28 |
sp|Q15ZS0|UPP_PSEA6 | Uracil phosphoribosyltransferase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=upp PE=3 SV=1 | 12 | 223 | 3.0E-28 |
sp|Q6AHB4|UPP_LEIXX | Uracil phosphoribosyltransferase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=upp PE=3 SV=1 | 7 | 224 | 4.0E-28 |
sp|P43857|UPP_HAEIN | Uracil phosphoribosyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=upp PE=3 SV=1 | 12 | 223 | 4.0E-28 |
sp|A5UF76|UPP_HAEIG | Uracil phosphoribosyltransferase OS=Haemophilus influenzae (strain PittGG) GN=upp PE=3 SV=1 | 12 | 223 | 4.0E-28 |
sp|A5UBP1|UPP_HAEIE | Uracil phosphoribosyltransferase OS=Haemophilus influenzae (strain PittEE) GN=upp PE=3 SV=1 | 12 | 223 | 4.0E-28 |
sp|Q92T49|UPP_RHIME | Uracil phosphoribosyltransferase OS=Rhizobium meliloti (strain 1021) GN=upp PE=3 SV=1 | 8 | 223 | 4.0E-28 |
sp|Q311Z9|UPP_DESAG | Uracil phosphoribosyltransferase OS=Desulfovibrio alaskensis (strain G20) GN=upp PE=3 SV=1 | 8 | 223 | 4.0E-28 |
sp|Q0HTW9|UPP_SHESR | Uracil phosphoribosyltransferase OS=Shewanella sp. (strain MR-7) GN=upp PE=3 SV=1 | 12 | 223 | 5.0E-28 |
sp|Q0HHL7|UPP_SHESM | Uracil phosphoribosyltransferase OS=Shewanella sp. (strain MR-4) GN=upp PE=3 SV=1 | 12 | 223 | 5.0E-28 |
sp|Q8EDI9|UPP_SHEON | Uracil phosphoribosyltransferase OS=Shewanella oneidensis (strain MR-1) GN=upp PE=3 SV=1 | 12 | 223 | 5.0E-28 |
sp|A4SL29|UPP_AERS4 | Uracil phosphoribosyltransferase OS=Aeromonas salmonicida (strain A449) GN=upp PE=3 SV=1 | 12 | 223 | 5.0E-28 |
sp|A0KM23|UPP_AERHH | Uracil phosphoribosyltransferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=upp PE=3 SV=1 | 12 | 223 | 5.0E-28 |
sp|C5BXA3|UPP_BEUC1 | Uracil phosphoribosyltransferase OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=upp PE=3 SV=1 | 7 | 221 | 5.0E-28 |
sp|A1JKZ8|UPP_YERE8 | Uracil phosphoribosyltransferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=upp PE=3 SV=1 | 12 | 223 | 6.0E-28 |
sp|Q8UJ06|UPP_AGRFC | Uracil phosphoribosyltransferase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=upp PE=3 SV=1 | 8 | 223 | 6.0E-28 |
sp|B0UW86|UPP_HISS2 | Uracil phosphoribosyltransferase OS=Histophilus somni (strain 2336) GN=upp PE=3 SV=1 | 12 | 223 | 6.0E-28 |
sp|Q0I4P2|UPP_HAES1 | Uracil phosphoribosyltransferase OS=Haemophilus somnus (strain 129Pt) GN=upp PE=3 SV=1 | 12 | 223 | 6.0E-28 |
sp|A5IYF5|UPP_MYCAP | Uracil phosphoribosyltransferase OS=Mycoplasma agalactiae (strain PG2) GN=upp PE=3 SV=1 | 13 | 223 | 1.0E-27 |
sp|P0A2M5|UPP_SALTY | Uracil phosphoribosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=upp PE=3 SV=1 | 12 | 223 | 1.0E-27 |
sp|P0A2M6|UPP_SALTI | Uracil phosphoribosyltransferase OS=Salmonella typhi GN=upp PE=3 SV=1 | 12 | 223 | 1.0E-27 |
sp|B4TR74|UPP_SALSV | Uracil phosphoribosyltransferase OS=Salmonella schwarzengrund (strain CVM19633) GN=upp PE=3 SV=1 | 12 | 223 | 1.0E-27 |
sp|B5BB06|UPP_SALPK | Uracil phosphoribosyltransferase OS=Salmonella paratyphi A (strain AKU_12601) GN=upp PE=3 SV=1 | 12 | 223 | 1.0E-27 |
sp|C0PYQ8|UPP_SALPC | Uracil phosphoribosyltransferase OS=Salmonella paratyphi C (strain RKS4594) GN=upp PE=3 SV=1 | 12 | 223 | 1.0E-27 |
sp|A9N2Y1|UPP_SALPB | Uracil phosphoribosyltransferase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=upp PE=3 SV=1 | 12 | 223 | 1.0E-27 |
sp|Q5PNJ7|UPP_SALPA | Uracil phosphoribosyltransferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=upp PE=3 SV=1 | 12 | 223 | 1.0E-27 |
sp|B4T0M7|UPP_SALNS | Uracil phosphoribosyltransferase OS=Salmonella newport (strain SL254) GN=upp PE=3 SV=1 | 12 | 223 | 1.0E-27 |
sp|B4TD73|UPP_SALHS | Uracil phosphoribosyltransferase OS=Salmonella heidelberg (strain SL476) GN=upp PE=3 SV=1 | 12 | 223 | 1.0E-27 |
sp|B5RCX0|UPP_SALG2 | Uracil phosphoribosyltransferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=upp PE=3 SV=1 | 12 | 223 | 1.0E-27 |
sp|B5R560|UPP_SALEP | Uracil phosphoribosyltransferase OS=Salmonella enteritidis PT4 (strain P125109) GN=upp PE=3 SV=1 | 12 | 223 | 1.0E-27 |
sp|B5FQJ0|UPP_SALDC | Uracil phosphoribosyltransferase OS=Salmonella dublin (strain CT_02021853) GN=upp PE=3 SV=1 | 12 | 223 | 1.0E-27 |
sp|Q57LL1|UPP_SALCH | Uracil phosphoribosyltransferase OS=Salmonella choleraesuis (strain SC-B67) GN=upp PE=3 SV=1 | 12 | 223 | 1.0E-27 |
sp|A9MHP1|UPP_SALAR | Uracil phosphoribosyltransferase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=upp PE=3 SV=1 | 12 | 223 | 1.0E-27 |
sp|B5F173|UPP_SALA4 | Uracil phosphoribosyltransferase OS=Salmonella agona (strain SL483) GN=upp PE=3 SV=1 | 12 | 223 | 1.0E-27 |
sp|Q1DG16|UPP_MYXXD | Uracil phosphoribosyltransferase OS=Myxococcus xanthus (strain DK 1622) GN=upp PE=3 SV=1 | 7 | 223 | 1.0E-27 |
sp|B7LKE4|UPP_ESCF3 | Uracil phosphoribosyltransferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=upp PE=3 SV=1 | 12 | 223 | 2.0E-27 |
sp|P0A8F3|UPP_SHIFL | Uracil phosphoribosyltransferase OS=Shigella flexneri GN=upp PE=3 SV=1 | 12 | 223 | 2.0E-27 |
sp|Q0T222|UPP_SHIF8 | Uracil phosphoribosyltransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=upp PE=3 SV=1 | 12 | 223 | 2.0E-27 |
sp|B2TXS3|UPP_SHIB3 | Uracil phosphoribosyltransferase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=upp PE=3 SV=1 | 12 | 223 | 2.0E-27 |
sp|B1LNE8|UPP_ECOSM | Uracil phosphoribosyltransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=upp PE=3 SV=1 | 12 | 223 | 2.0E-27 |
sp|B6I570|UPP_ECOSE | Uracil phosphoribosyltransferase OS=Escherichia coli (strain SE11) GN=upp PE=3 SV=1 | 12 | 223 | 2.0E-27 |
sp|B7N680|UPP_ECOLU | Uracil phosphoribosyltransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=upp PE=3 SV=1 | 12 | 223 | 2.0E-27 |
sp|P0A8F0|UPP_ECOLI | Uracil phosphoribosyltransferase OS=Escherichia coli (strain K12) GN=upp PE=1 SV=1 | 12 | 223 | 2.0E-27 |
sp|B1IWG2|UPP_ECOLC | Uracil phosphoribosyltransferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=upp PE=3 SV=1 | 12 | 223 | 2.0E-27 |
sp|P0A8F1|UPP_ECOL6 | Uracil phosphoribosyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=upp PE=3 SV=1 | 12 | 223 | 2.0E-27 |
sp|Q0TEZ0|UPP_ECOL5 | Uracil phosphoribosyltransferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=upp PE=3 SV=1 | 12 | 223 | 2.0E-27 |
sp|A1ADZ1|UPP_ECOK1 | Uracil phosphoribosyltransferase OS=Escherichia coli O1:K1 / APEC GN=upp PE=3 SV=1 | 12 | 223 | 2.0E-27 |
sp|A8A2Z0|UPP_ECOHS | Uracil phosphoribosyltransferase OS=Escherichia coli O9:H4 (strain HS) GN=upp PE=3 SV=1 | 12 | 223 | 2.0E-27 |
sp|B1XAX3|UPP_ECODH | Uracil phosphoribosyltransferase OS=Escherichia coli (strain K12 / DH10B) GN=upp PE=3 SV=1 | 12 | 223 | 2.0E-27 |
sp|C4ZX73|UPP_ECOBW | Uracil phosphoribosyltransferase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=upp PE=3 SV=1 | 12 | 223 | 2.0E-27 |
sp|B7M7K2|UPP_ECO8A | Uracil phosphoribosyltransferase OS=Escherichia coli O8 (strain IAI1) GN=upp PE=3 SV=1 | 12 | 223 | 2.0E-27 |
sp|B7MYC5|UPP_ECO81 | Uracil phosphoribosyltransferase OS=Escherichia coli O81 (strain ED1a) GN=upp PE=3 SV=1 | 12 | 223 | 2.0E-27 |
sp|B7NQN7|UPP_ECO7I | Uracil phosphoribosyltransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=upp PE=3 SV=1 | 12 | 223 | 2.0E-27 |
sp|B5Z035|UPP_ECO5E | Uracil phosphoribosyltransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=upp PE=3 SV=1 | 12 | 223 | 2.0E-27 |
sp|P0A8F2|UPP_ECO57 | Uracil phosphoribosyltransferase OS=Escherichia coli O157:H7 GN=upp PE=3 SV=1 | 12 | 223 | 2.0E-27 |
sp|B7LCN8|UPP_ECO55 | Uracil phosphoribosyltransferase OS=Escherichia coli (strain 55989 / EAEC) GN=upp PE=3 SV=1 | 12 | 223 | 2.0E-27 |
sp|B7MHX9|UPP_ECO45 | Uracil phosphoribosyltransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=upp PE=3 SV=1 | 12 | 223 | 2.0E-27 |
sp|B7UGN6|UPP_ECO27 | Uracil phosphoribosyltransferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=upp PE=3 SV=1 | 12 | 223 | 2.0E-27 |
sp|A7ZPU1|UPP_ECO24 | Uracil phosphoribosyltransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=upp PE=3 SV=1 | 12 | 223 | 2.0E-27 |
sp|B5EBM3|UPP_GEOBB | Uracil phosphoribosyltransferase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=upp PE=3 SV=1 | 7 | 223 | 2.0E-27 |
sp|A0KYA2|UPP_SHESA | Uracil phosphoribosyltransferase OS=Shewanella sp. (strain ANA-3) GN=upp PE=3 SV=1 | 12 | 223 | 2.0E-27 |
sp|A8FUD4|UPP_SHESH | Uracil phosphoribosyltransferase OS=Shewanella sediminis (strain HAW-EB3) GN=upp PE=3 SV=1 | 12 | 223 | 2.0E-27 |
sp|A9BWD4|UPP_DELAS | Uracil phosphoribosyltransferase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=upp PE=3 SV=1 | 6 | 223 | 2.0E-27 |
sp|B4EY88|UPP_PROMH | Uracil phosphoribosyltransferase OS=Proteus mirabilis (strain HI4320) GN=upp PE=3 SV=1 | 12 | 223 | 2.0E-27 |
sp|B1JSF5|UPP_YERPY | Uracil phosphoribosyltransferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=upp PE=3 SV=1 | 12 | 223 | 2.0E-27 |
sp|Q668E6|UPP_YERPS | Uracil phosphoribosyltransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=upp PE=3 SV=1 | 12 | 223 | 2.0E-27 |
sp|A4TMP2|UPP_YERPP | Uracil phosphoribosyltransferase OS=Yersinia pestis (strain Pestoides F) GN=upp PE=3 SV=1 | 12 | 223 | 2.0E-27 |
sp|Q1CK39|UPP_YERPN | Uracil phosphoribosyltransferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=upp PE=3 SV=1 | 12 | 223 | 2.0E-27 |
sp|A9QZW6|UPP_YERPG | Uracil phosphoribosyltransferase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=upp PE=3 SV=1 | 12 | 223 | 2.0E-27 |
sp|Q8ZCX9|UPP_YERPE | Uracil phosphoribosyltransferase OS=Yersinia pestis GN=upp PE=3 SV=1 | 12 | 223 | 2.0E-27 |
sp|B2K9J9|UPP_YERPB | Uracil phosphoribosyltransferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=upp PE=3 SV=1 | 12 | 223 | 2.0E-27 |
sp|Q1C5P3|UPP_YERPA | Uracil phosphoribosyltransferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=upp PE=3 SV=1 | 12 | 223 | 2.0E-27 |
sp|A7FG38|UPP_YERP3 | Uracil phosphoribosyltransferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=upp PE=3 SV=1 | 12 | 223 | 2.0E-27 |
sp|A1VN11|UPP_POLNA | Uracil phosphoribosyltransferase OS=Polaromonas naphthalenivorans (strain CJ2) GN=upp PE=3 SV=1 | 6 | 223 | 2.0E-27 |
sp|B4RK50|UPP_NEIG2 | Uracil phosphoribosyltransferase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=upp PE=3 SV=1 | 7 | 223 | 3.0E-27 |
sp|Q5F9P0|UPP_NEIG1 | Uracil phosphoribosyltransferase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=upp PE=3 SV=1 | 7 | 223 | 3.0E-27 |
sp|C5BHQ5|UPP_EDWI9 | Uracil phosphoribosyltransferase OS=Edwardsiella ictaluri (strain 93-146) GN=upp PE=3 SV=1 | 12 | 223 | 3.0E-27 |
sp|A9KY39|UPP_SHEB9 | Uracil phosphoribosyltransferase OS=Shewanella baltica (strain OS195) GN=upp PE=3 SV=1 | 12 | 223 | 3.0E-27 |
sp|A6WM35|UPP_SHEB8 | Uracil phosphoribosyltransferase OS=Shewanella baltica (strain OS185) GN=upp PE=3 SV=1 | 12 | 223 | 3.0E-27 |
sp|A3D3D2|UPP_SHEB5 | Uracil phosphoribosyltransferase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=upp PE=3 SV=1 | 12 | 223 | 3.0E-27 |
sp|B8EAL3|UPP_SHEB2 | Uracil phosphoribosyltransferase OS=Shewanella baltica (strain OS223) GN=upp PE=3 SV=1 | 12 | 223 | 3.0E-27 |
sp|B3DPH5|UPP_BIFLD | Uracil phosphoribosyltransferase OS=Bifidobacterium longum (strain DJO10A) GN=upp PE=3 SV=1 | 7 | 221 | 3.0E-27 |
sp|A1RKQ4|UPP_SHESW | Uracil phosphoribosyltransferase OS=Shewanella sp. (strain W3-18-1) GN=upp PE=3 SV=1 | 12 | 223 | 3.0E-27 |
sp|A4Y5T9|UPP_SHEPC | Uracil phosphoribosyltransferase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=upp PE=3 SV=1 | 12 | 223 | 3.0E-27 |
sp|B0T2R0|UPP_CAUSK | Uracil phosphoribosyltransferase OS=Caulobacter sp. (strain K31) GN=upp PE=3 SV=1 | 6 | 223 | 4.0E-27 |
sp|B7GNR5|UPP_BIFLS | Uracil phosphoribosyltransferase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=upp PE=3 SV=1 | 7 | 221 | 4.0E-27 |
sp|A4WD70|UPP_ENT38 | Uracil phosphoribosyltransferase OS=Enterobacter sp. (strain 638) GN=upp PE=3 SV=1 | 12 | 223 | 4.0E-27 |
sp|C1DEU0|UPP_AZOVD | Uracil phosphoribosyltransferase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=upp PE=3 SV=1 | 8 | 226 | 5.0E-27 |
sp|C6DBR1|UPP_PECCP | Uracil phosphoribosyltransferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=upp PE=3 SV=1 | 12 | 223 | 6.0E-27 |
sp|Q7N3F8|UPP_PHOLL | Uracil phosphoribosyltransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=upp PE=3 SV=1 | 13 | 223 | 6.0E-27 |
sp|C4LC66|UPP_TOLAT | Uracil phosphoribosyltransferase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=upp PE=3 SV=1 | 12 | 223 | 7.0E-27 |
sp|A6UET4|UPP_SINMW | Uracil phosphoribosyltransferase OS=Sinorhizobium medicae (strain WSM419) GN=upp PE=3 SV=1 | 8 | 223 | 7.0E-27 |
sp|A8AD93|UPP_CITK8 | Uracil phosphoribosyltransferase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=upp PE=3 SV=1 | 12 | 223 | 8.0E-27 |
sp|A1SVA9|UPP_PSYIN | Uracil phosphoribosyltransferase OS=Psychromonas ingrahamii (strain 37) GN=upp PE=3 SV=1 | 12 | 223 | 9.0E-27 |
sp|B1KIG8|UPP_SHEWM | Uracil phosphoribosyltransferase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=upp PE=3 SV=1 | 12 | 223 | 9.0E-27 |
sp|Q7NS06|UPP_CHRVO | Uracil phosphoribosyltransferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=upp PE=3 SV=1 | 7 | 223 | 9.0E-27 |
sp|P75081|UPP_MYCPN | Uracil phosphoribosyltransferase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=upp PE=3 SV=2 | 13 | 223 | 9.0E-27 |
sp|Q2KWB3|UPP_BORA1 | Uracil phosphoribosyltransferase OS=Bordetella avium (strain 197N) GN=upp PE=3 SV=1 | 8 | 226 | 9.0E-27 |
sp|A8H5Q9|UPP_SHEPA | Uracil phosphoribosyltransferase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=upp PE=3 SV=1 | 12 | 223 | 9.0E-27 |
sp|B0TPW8|UPP_SHEHH | Uracil phosphoribosyltransferase OS=Shewanella halifaxensis (strain HAW-EB4) GN=upp PE=3 SV=1 | 12 | 223 | 9.0E-27 |
sp|B9J6V7|UPP_AGRRK | Uracil phosphoribosyltransferase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=upp PE=3 SV=1 | 8 | 223 | 1.0E-26 |
sp|Q6D7S0|UPP_PECAS | Uracil phosphoribosyltransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=upp PE=3 SV=1 | 12 | 223 | 1.0E-26 |
sp|B5XNQ4|UPP_KLEP3 | Uracil phosphoribosyltransferase OS=Klebsiella pneumoniae (strain 342) GN=upp PE=3 SV=1 | 12 | 223 | 1.0E-26 |
sp|A6TCB0|UPP_KLEP7 | Uracil phosphoribosyltransferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=upp PE=3 SV=1 | 12 | 223 | 2.0E-26 |
sp|Q7VRS9|UPP_BLOFL | Uracil phosphoribosyltransferase OS=Blochmannia floridanus GN=upp PE=3 SV=1 | 12 | 223 | 2.0E-26 |
sp|Q492F3|UPP_BLOPB | Uracil phosphoribosyltransferase OS=Blochmannia pennsylvanicus (strain BPEN) GN=upp PE=3 SV=1 | 77 | 223 | 2.0E-26 |
sp|B2GFU4|UPP_KOCRD | Uracil phosphoribosyltransferase OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=upp PE=3 SV=1 | 7 | 221 | 2.0E-26 |
sp|P47276|UPP_MYCGE | Uracil phosphoribosyltransferase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=upp PE=3 SV=1 | 12 | 221 | 2.0E-26 |
sp|A1U241|UPP_MARHV | Uracil phosphoribosyltransferase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=upp PE=3 SV=1 | 8 | 226 | 3.0E-26 |
sp|A0ZZM2|UPP_BIFAA | Uracil phosphoribosyltransferase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=upp PE=3 SV=1 | 7 | 221 | 4.0E-26 |
sp|Q2SN06|UPP_HAHCH | Uracil phosphoribosyltransferase OS=Hahella chejuensis (strain KCTC 2396) GN=upp PE=3 SV=1 | 9 | 226 | 6.0E-26 |
sp|A1SDD5|UPP_NOCSJ | Uracil phosphoribosyltransferase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=upp PE=3 SV=1 | 9 | 225 | 7.0E-26 |
sp|P72753|UPP_SYNY3 | Uracil phosphoribosyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=upp PE=3 SV=1 | 8 | 221 | 7.0E-26 |
sp|A5CNC6|UPP_CLAM3 | Uracil phosphoribosyltransferase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=upp PE=3 SV=1 | 7 | 223 | 7.0E-26 |
sp|Q9JV58|UPP_NEIMA | Uracil phosphoribosyltransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=upp PE=3 SV=1 | 7 | 223 | 7.0E-26 |
sp|B6IW12|UPP_RHOCS | Uracil phosphoribosyltransferase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=upp PE=3 SV=1 | 7 | 223 | 9.0E-26 |
sp|Q2SZS9|UPP_BURTA | Uracil phosphoribosyltransferase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=upp PE=3 SV=1 | 7 | 223 | 1.0E-25 |
sp|Q9K048|UPP_NEIMB | Uracil phosphoribosyltransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=upp PE=3 SV=1 | 7 | 223 | 1.0E-25 |
sp|B8DVI9|UPP_BIFA0 | Uracil phosphoribosyltransferase OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=upp PE=3 SV=1 | 7 | 221 | 1.0E-25 |
sp|Q7WB58|UPP_BORPA | Uracil phosphoribosyltransferase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=upp PE=3 SV=1 | 8 | 226 | 1.0E-25 |
sp|Q7WMM5|UPP_BORBR | Uracil phosphoribosyltransferase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=upp PE=3 SV=1 | 8 | 226 | 1.0E-25 |
sp|A1KT34|UPP_NEIMF | Uracil phosphoribosyltransferase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=upp PE=3 SV=1 | 7 | 223 | 1.0E-25 |
sp|A9M3K6|UPP_NEIM0 | Uracil phosphoribosyltransferase OS=Neisseria meningitidis serogroup C (strain 053442) GN=upp PE=3 SV=1 | 7 | 223 | 1.0E-25 |
sp|Q2A285|UPP_FRATH | Uracil phosphoribosyltransferase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=upp PE=3 SV=1 | 13 | 223 | 1.0E-25 |
sp|A3N7G1|UPP_BURP6 | Uracil phosphoribosyltransferase OS=Burkholderia pseudomallei (strain 668) GN=upp PE=3 SV=1 | 7 | 223 | 1.0E-25 |
sp|A6W572|UPP_KINRD | Uracil phosphoribosyltransferase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=upp PE=3 SV=1 | 7 | 221 | 1.0E-25 |
sp|A4IZ90|UPP_FRATW | Uracil phosphoribosyltransferase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=upp PE=3 SV=1 | 13 | 223 | 1.0E-25 |
sp|Q5NGW1|UPP_FRATT | Uracil phosphoribosyltransferase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=upp PE=3 SV=2 | 13 | 223 | 1.0E-25 |
sp|A0Q5K6|UPP_FRATN | Uracil phosphoribosyltransferase OS=Francisella tularensis subsp. novicida (strain U112) GN=upp PE=3 SV=1 | 13 | 223 | 1.0E-25 |
sp|Q63VS8|UPP_BURPS | Uracil phosphoribosyltransferase OS=Burkholderia pseudomallei (strain K96243) GN=upp PE=1 SV=1 | 7 | 223 | 2.0E-25 |
sp|Q3JUF6|UPP_BURP1 | Uracil phosphoribosyltransferase OS=Burkholderia pseudomallei (strain 1710b) GN=upp PE=3 SV=1 | 7 | 223 | 2.0E-25 |
sp|A3NT50|UPP_BURP0 | Uracil phosphoribosyltransferase OS=Burkholderia pseudomallei (strain 1106a) GN=upp PE=3 SV=1 | 7 | 223 | 2.0E-25 |
sp|A1V2G4|UPP_BURMS | Uracil phosphoribosyltransferase OS=Burkholderia mallei (strain SAVP1) GN=upp PE=3 SV=1 | 7 | 223 | 2.0E-25 |
sp|Q62IJ1|UPP_BURMA | Uracil phosphoribosyltransferase OS=Burkholderia mallei (strain ATCC 23344) GN=upp PE=3 SV=1 | 7 | 223 | 2.0E-25 |
sp|A2S4B1|UPP_BURM9 | Uracil phosphoribosyltransferase OS=Burkholderia mallei (strain NCTC 10229) GN=upp PE=3 SV=1 | 7 | 223 | 2.0E-25 |
sp|A3MI49|UPP_BURM7 | Uracil phosphoribosyltransferase OS=Burkholderia mallei (strain NCTC 10247) GN=upp PE=3 SV=1 | 7 | 223 | 2.0E-25 |
sp|B0TYR5|UPP_FRAP2 | Uracil phosphoribosyltransferase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=upp PE=3 SV=1 | 12 | 223 | 2.0E-25 |
sp|P93394|UPP_TOBAC | Uracil phosphoribosyltransferase OS=Nicotiana tabacum GN=UPP PE=2 SV=1 | 8 | 223 | 2.0E-25 |
sp|Q9HVE6|UPP_PSEAE | Uracil phosphoribosyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=upp PE=3 SV=1 | 8 | 226 | 2.0E-25 |
sp|Q02G28|UPP_PSEAB | Uracil phosphoribosyltransferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=upp PE=3 SV=1 | 8 | 226 | 2.0E-25 |
sp|B7V0J2|UPP_PSEA8 | Uracil phosphoribosyltransferase OS=Pseudomonas aeruginosa (strain LESB58) GN=upp PE=3 SV=1 | 8 | 226 | 2.0E-25 |
sp|O67914|UPP_AQUAE | Uracil phosphoribosyltransferase OS=Aquifex aeolicus (strain VF5) GN=upp PE=1 SV=1 | 13 | 221 | 2.0E-25 |
sp|A3QD33|UPP_SHELP | Uracil phosphoribosyltransferase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=upp PE=3 SV=1 | 12 | 223 | 2.0E-25 |
sp|Q89E48|UPP_BRADU | Uracil phosphoribosyltransferase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=upp PE=3 SV=1 | 6 | 223 | 3.0E-25 |
sp|Q084L0|UPP_SHEFN | Uracil phosphoribosyltransferase OS=Shewanella frigidimarina (strain NCIMB 400) GN=upp PE=3 SV=1 | 12 | 223 | 3.0E-25 |
sp|B8CN81|UPP_SHEPW | Uracil phosphoribosyltransferase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=upp PE=3 SV=1 | 12 | 223 | 3.0E-25 |
sp|A6VC42|UPP_PSEA7 | Uracil phosphoribosyltransferase OS=Pseudomonas aeruginosa (strain PA7) GN=upp PE=3 SV=1 | 8 | 226 | 3.0E-25 |
sp|A1S7E5|UPP_SHEAM | Uracil phosphoribosyltransferase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=upp PE=3 SV=1 | 12 | 223 | 3.0E-25 |
sp|A1R2Y2|UPP_ARTAT | Uracil phosphoribosyltransferase OS=Arthrobacter aurescens (strain TC1) GN=upp PE=3 SV=1 | 10 | 221 | 4.0E-25 |
sp|B2JE33|UPP_BURP8 | Uracil phosphoribosyltransferase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=upp PE=3 SV=1 | 7 | 223 | 4.0E-25 |
sp|B9JYP9|UPP_AGRVS | Uracil phosphoribosyltransferase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=upp PE=3 SV=1 | 8 | 223 | 4.0E-25 |
sp|Q2NS69|UPP_SODGM | Uracil phosphoribosyltransferase OS=Sodalis glossinidius (strain morsitans) GN=upp PE=3 SV=1 | 12 | 223 | 5.0E-25 |
sp|Q7VZ79|UPP_BORPE | Uracil phosphoribosyltransferase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=upp PE=3 SV=1 | 8 | 226 | 6.0E-25 |
sp|Q39EA2|UPP_BURL3 | Uracil phosphoribosyltransferase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=upp PE=3 SV=1 | 7 | 223 | 6.0E-25 |
sp|A4XQU8|UPP_PSEMY | Uracil phosphoribosyltransferase OS=Pseudomonas mendocina (strain ymp) GN=upp PE=3 SV=1 | 12 | 226 | 7.0E-25 |
sp|Q142L5|UPP_BURXL | Uracil phosphoribosyltransferase OS=Burkholderia xenovorans (strain LB400) GN=upp PE=3 SV=1 | 7 | 223 | 7.0E-25 |
sp|Q88PV2|UPP_PSEPK | Uracil phosphoribosyltransferase OS=Pseudomonas putida (strain KT2440) GN=upp PE=3 SV=1 | 12 | 226 | 7.0E-25 |
sp|B0KNF7|UPP_PSEPG | Uracil phosphoribosyltransferase OS=Pseudomonas putida (strain GB-1) GN=upp PE=3 SV=1 | 12 | 226 | 7.0E-25 |
sp|A5VYH8|UPP_PSEP1 | Uracil phosphoribosyltransferase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=upp PE=3 SV=1 | 12 | 226 | 7.0E-25 |
sp|B2T2A6|UPP_BURPP | Uracil phosphoribosyltransferase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=upp PE=3 SV=1 | 7 | 223 | 8.0E-25 |
sp|A2SGT8|UPP_METPP | Uracil phosphoribosyltransferase OS=Methylibium petroleiphilum (strain PM1) GN=upp PE=3 SV=1 | 13 | 225 | 8.0E-25 |
sp|B2HDV9|UPP_MYCMM | Uracil phosphoribosyltransferase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=upp PE=3 SV=1 | 7 | 221 | 8.0E-25 |
sp|B2SDI9|UPP_FRATM | Uracil phosphoribosyltransferase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=upp PE=3 SV=1 | 13 | 223 | 9.0E-25 |
sp|Q9AK76|UPP_STRCO | Uracil phosphoribosyltransferase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=upp PE=3 SV=2 | 7 | 221 | 1.0E-24 |
sp|Q1IEV9|UPP_PSEE4 | Uracil phosphoribosyltransferase OS=Pseudomonas entomophila (strain L48) GN=upp PE=3 SV=1 | 12 | 226 | 1.0E-24 |
sp|A1WQN5|UPP_VEREI | Uracil phosphoribosyltransferase OS=Verminephrobacter eiseniae (strain EF01-2) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-24 |
sp|Q12MF1|UPP_SHEDO | Uracil phosphoribosyltransferase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=upp PE=3 SV=1 | 12 | 223 | 2.0E-24 |
sp|B1JEN1|UPP_PSEPW | Uracil phosphoribosyltransferase OS=Pseudomonas putida (strain W619) GN=upp PE=3 SV=1 | 12 | 226 | 2.0E-24 |
sp|B2U8Z0|UPP_RALPJ | Uracil phosphoribosyltransferase OS=Ralstonia pickettii (strain 12J) GN=upp PE=3 SV=1 | 7 | 223 | 2.0E-24 |
sp|A4JGH4|UPP_BURVG | Uracil phosphoribosyltransferase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=upp PE=3 SV=1 | 7 | 223 | 2.0E-24 |
sp|A4VPB2|UPP_PSEU5 | Uracil phosphoribosyltransferase OS=Pseudomonas stutzeri (strain A1501) GN=upp PE=3 SV=1 | 12 | 226 | 2.0E-24 |
sp|A9AJK1|UPP_BURM1 | Uracil phosphoribosyltransferase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=upp PE=3 SV=1 | 7 | 223 | 2.0E-24 |
sp|B1VNY5|UPP_STRGG | Uracil phosphoribosyltransferase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=upp PE=3 SV=1 | 7 | 221 | 2.0E-24 |
sp|B1JW40|UPP_BURCC | Uracil phosphoribosyltransferase OS=Burkholderia cenocepacia (strain MC0-3) GN=upp PE=3 SV=1 | 7 | 223 | 2.0E-24 |
sp|B1YU48|UPP_BURA4 | Uracil phosphoribosyltransferase OS=Burkholderia ambifaria (strain MC40-6) GN=upp PE=3 SV=1 | 7 | 223 | 2.0E-24 |
sp|B8HCL2|UPP_ARTCA | Uracil phosphoribosyltransferase OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=upp PE=3 SV=1 | 10 | 221 | 4.0E-24 |
sp|A0JSM6|UPP_ARTS2 | Uracil phosphoribosyltransferase OS=Arthrobacter sp. (strain FB24) GN=upp PE=3 SV=1 | 10 | 221 | 4.0E-24 |
sp|Q0BD86|UPP_BURCM | Uracil phosphoribosyltransferase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=upp PE=3 SV=1 | 7 | 223 | 4.0E-24 |
sp|B4E5R5|UPP_BURCJ | Uracil phosphoribosyltransferase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=upp PE=3 SV=1 | 7 | 223 | 5.0E-24 |
sp|Q8XXC7|UPP_RALSO | Uracil phosphoribosyltransferase OS=Ralstonia solanacearum (strain GMI1000) GN=upp PE=3 SV=1 | 7 | 223 | 6.0E-24 |
sp|A9HZV9|UPP_BORPD | Uracil phosphoribosyltransferase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=upp PE=3 SV=1 | 8 | 226 | 9.0E-24 |
sp|P9WFF3|UPP_MYCTU | Uracil phosphoribosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=upp PE=1 SV=1 | 7 | 221 | 2.0E-23 |
sp|P9WFF2|UPP_MYCTO | Uracil phosphoribosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=upp PE=3 SV=1 | 7 | 221 | 2.0E-23 |
sp|A5U7Y3|UPP_MYCTA | Uracil phosphoribosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=upp PE=3 SV=1 | 7 | 221 | 2.0E-23 |
sp|A1KNZ5|UPP_MYCBP | Uracil phosphoribosyltransferase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=upp PE=3 SV=1 | 7 | 221 | 2.0E-23 |
sp|P0A659|UPP_MYCBO | Uracil phosphoribosyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=upp PE=3 SV=1 | 7 | 221 | 2.0E-23 |
sp|Q4K6B5|UPP_PSEF5 | Uracil phosphoribosyltransferase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=upp PE=3 SV=1 | 12 | 226 | 6.0E-23 |
sp|Q82FS4|UPP_STRAW | Uracil phosphoribosyltransferase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=upp PE=3 SV=1 | 7 | 221 | 7.0E-23 |
sp|Q9M336|UPP_ARATH | Uracil phosphoribosyltransferase, chloroplastic OS=Arabidopsis thaliana GN=UPP PE=1 SV=1 | 8 | 223 | 1.0E-22 |
sp|C3KAJ8|UPP_PSEFS | Uracil phosphoribosyltransferase OS=Pseudomonas fluorescens (strain SBW25) GN=upp PE=3 SV=1 | 12 | 226 | 1.0E-22 |
sp|C4LKC1|UPP_CORK4 | Uracil phosphoribosyltransferase OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=upp PE=3 SV=1 | 7 | 221 | 1.0E-22 |
sp|Q4ZXU7|UPP_PSEU2 | Uracil phosphoribosyltransferase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=upp PE=3 SV=1 | 12 | 226 | 3.0E-22 |
sp|Q48MT3|UPP_PSE14 | Uracil phosphoribosyltransferase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=upp PE=3 SV=1 | 12 | 226 | 3.0E-22 |
sp|B1MFZ1|UPP_MYCA9 | Uracil phosphoribosyltransferase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=upp PE=3 SV=1 | 7 | 221 | 6.0E-22 |
sp|Q888A0|UPP_PSESM | Uracil phosphoribosyltransferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=upp PE=3 SV=1 | 12 | 226 | 7.0E-22 |
sp|Q4JTK4|UPP_CORJK | Uracil phosphoribosyltransferase OS=Corynebacterium jeikeium (strain K411) GN=upp PE=3 SV=1 | 7 | 221 | 1.0E-21 |
sp|Q3K6Y9|UPP_PSEPF | Uracil phosphoribosyltransferase OS=Pseudomonas fluorescens (strain Pf0-1) GN=upp PE=3 SV=1 | 12 | 226 | 2.0E-21 |
sp|Q73UD7|UPP_MYCPA | Uracil phosphoribosyltransferase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=upp PE=3 SV=1 | 7 | 221 | 2.0E-21 |
sp|Q6A5S3|UPP_PROAC | Uracil phosphoribosyltransferase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=upp PE=3 SV=1 | 7 | 221 | 3.0E-21 |
sp|Q74EM9|UPP_GEOSL | Uracil phosphoribosyltransferase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=upp PE=3 SV=1 | 77 | 223 | 5.0E-21 |
sp|B1VF60|UPP_CORU7 | Uracil phosphoribosyltransferase OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=upp PE=3 SV=1 | 7 | 221 | 2.0E-20 |
sp|C3PLD0|UPP_CORA7 | Uracil phosphoribosyltransferase OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=upp PE=3 SV=1 | 7 | 221 | 3.0E-20 |
sp|A9WLN5|UPP_RENSM | Uracil phosphoribosyltransferase OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=upp PE=3 SV=1 | 7 | 225 | 1.0E-19 |
sp|Q8YVB5|UPP_NOSS1 | Uracil phosphoribosyltransferase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=upp PE=3 SV=1 | 7 | 221 | 1.0E-19 |
sp|P58998|UPP_CORGL | Uracil phosphoribosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=upp PE=3 SV=1 | 7 | 221 | 2.0E-19 |
sp|A4QC29|UPP_CORGB | Uracil phosphoribosyltransferase OS=Corynebacterium glutamicum (strain R) GN=upp PE=3 SV=1 | 7 | 221 | 2.0E-19 |
sp|Q6NIX4|UPP_CORDI | Uracil phosphoribosyltransferase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=upp PE=3 SV=1 | 7 | 221 | 2.0E-19 |
sp|Q8FRQ5|UPP_COREF | Uracil phosphoribosyltransferase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=upp PE=3 SV=2 | 7 | 221 | 3.0E-19 |
sp|Q5Z187|UPP_NOCFA | Uracil phosphoribosyltransferase OS=Nocardia farcinica (strain IFM 10152) GN=upp PE=3 SV=1 | 9 | 221 | 3.0E-18 |
sp|A4WMQ7|UPP_PYRAR | Uracil phosphoribosyltransferase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=upp PE=3 SV=1 | 8 | 223 | 6.0E-18 |
sp|Q975Z7|UPP_SULTO | Uracil phosphoribosyltransferase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=upp PE=3 SV=1 | 8 | 221 | 9.0E-17 |
sp|Q9V0K1|UPP_PYRAB | Uracil phosphoribosyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=upp PE=3 SV=1 | 14 | 221 | 1.0E-16 |
sp|Q26998|UPP_TOXGO | Uracil phosphoribosyltransferase OS=Toxoplasma gondii GN=uprt PE=1 SV=1 | 10 | 224 | 3.0E-15 |
sp|A1RV13|UPP_PYRIL | Uracil phosphoribosyltransferase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=upp PE=3 SV=1 | 8 | 223 | 6.0E-15 |
sp|Q4JAV0|UPP_SULAC | Uracil phosphoribosyltransferase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=upp PE=3 SV=1 | 8 | 221 | 2.0E-14 |
sp|Q980Q4|UPP_SULSO | Uracil phosphoribosyltransferase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=upp PE=1 SV=1 | 8 | 221 | 4.0E-14 |
sp|Q8ZWV9|UPP_PYRAE | Uracil phosphoribosyltransferase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=upp PE=3 SV=1 | 8 | 223 | 4.0E-14 |
sp|B6YTB2|UPP_THEON | Uracil phosphoribosyltransferase OS=Thermococcus onnurineus (strain NA1) GN=upp PE=3 SV=1 | 14 | 221 | 5.0E-14 |
sp|A5H0J4|UPP_LACKL | Uracil phosphoribosyltransferase OS=Lachancea kluyveri GN=FUR1 PE=3 SV=1 | 82 | 221 | 7.0E-14 |
sp|C6A3U9|UPP_THESM | Uracil phosphoribosyltransferase OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=upp PE=3 SV=1 | 136 | 221 | 1.0E-13 |
sp|P18562|UPP_YEAST | Uracil phosphoribosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUR1 PE=1 SV=2 | 82 | 221 | 2.0E-13 |
sp|O13867|UPP1_SCHPO | Uracil phosphoribosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.01c PE=3 SV=1 | 82 | 223 | 2.0E-13 |
sp|Q9YEN3|UPP_AERPE | Uracil phosphoribosyltransferase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=upp PE=3 SV=2 | 14 | 219 | 7.0E-13 |
sp|Q8U1G7|UPP_PYRFU | Uracil phosphoribosyltransferase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=upp PE=3 SV=1 | 136 | 221 | 7.0E-13 |
sp|C5A6P6|UPP_THEGJ | Uracil phosphoribosyltransferase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=upp PE=3 SV=1 | 142 | 221 | 1.0E-12 |
sp|Q55GQ6|UPP_DICDI | Uracil phosphoribosyltransferase OS=Dictyostelium discoideum GN=uprt PE=3 SV=1 | 63 | 223 | 1.0E-12 |
sp|A6VJY4|UPP_METM7 | Uracil phosphoribosyltransferase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=upp PE=3 SV=1 | 123 | 221 | 1.0E-12 |
sp|Q6LZE9|UPP_METMP | Uracil phosphoribosyltransferase OS=Methanococcus maripaludis (strain S2 / LL) GN=upp PE=3 SV=1 | 136 | 221 | 1.0E-12 |
sp|Q5JGQ6|UPP_THEKO | Uracil phosphoribosyltransferase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=upp PE=3 SV=1 | 14 | 221 | 2.0E-12 |
sp|C3N7P3|UPP_SULIY | Uracil phosphoribosyltransferase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=upp PE=3 SV=1 | 8 | 221 | 2.0E-12 |
sp|C3NFT0|UPP_SULIN | Uracil phosphoribosyltransferase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=upp PE=3 SV=1 | 8 | 221 | 2.0E-12 |
sp|C3MY92|UPP_SULIM | Uracil phosphoribosyltransferase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=upp PE=3 SV=1 | 8 | 221 | 2.0E-12 |
sp|C3MRJ6|UPP_SULIL | Uracil phosphoribosyltransferase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=upp PE=3 SV=1 | 8 | 221 | 2.0E-12 |
sp|C3MZM1|UPP_SULIA | Uracil phosphoribosyltransferase OS=Sulfolobus islandicus (strain M.16.27) GN=upp PE=3 SV=1 | 8 | 221 | 2.0E-12 |
sp|C4KIV1|UPP_SULIK | Uracil phosphoribosyltransferase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=upp PE=3 SV=1 | 8 | 221 | 2.0E-12 |
sp|Q9HN05|UPP_HALSA | Uracil phosphoribosyltransferase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=upp PE=3 SV=1 | 7 | 223 | 3.0E-12 |
sp|B0R7K0|UPP_HALS3 | Uracil phosphoribosyltransferase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=upp PE=3 SV=1 | 7 | 223 | 3.0E-12 |
sp|A9A7A5|UPP_METM6 | Uracil phosphoribosyltransferase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=upp PE=3 SV=1 | 142 | 221 | 3.0E-12 |
sp|A4FYB9|UPP_METM5 | Uracil phosphoribosyltransferase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=upp PE=3 SV=1 | 141 | 221 | 3.0E-11 |
sp|A6USD4|UPP_METVS | Uracil phosphoribosyltransferase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=upp PE=3 SV=1 | 136 | 221 | 7.0E-11 |
sp|A4YCQ1|UPP_METS5 | Uracil phosphoribosyltransferase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=upp PE=3 SV=1 | 136 | 221 | 6.0E-10 |
sp|Q55EL3|UCKA_DICDI | Uridine-cytidine kinase A OS=Dictyostelium discoideum GN=udkA PE=3 SV=1 | 4 | 223 | 6.0E-10 |
sp|Q3ISU0|UPP_NATPD | Uracil phosphoribosyltransferase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=upp PE=3 SV=1 | 6 | 223 | 1.0E-09 |
sp|B9LUM1|UPP_HALLT | Uracil phosphoribosyltransferase OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=upp PE=3 SV=1 | 6 | 224 | 4.0E-09 |
sp|Q9HE15|UPP2_SCHPO | Uracil phosphoribosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.04c PE=3 SV=1 | 5 | 223 | 5.0E-09 |
sp|Q91YL3|UCKL1_MOUSE | Uridine-cytidine kinase-like 1 OS=Mus musculus GN=Uckl1 PE=1 SV=1 | 3 | 223 | 3.0E-08 |
sp|Q9NWZ5|UCKL1_HUMAN | Uridine-cytidine kinase-like 1 OS=Homo sapiens GN=UCKL1 PE=1 SV=2 | 62 | 223 | 4.0E-08 |
Localizations | Signals | Cytoplasm | Nucleus | Extracellular | Cell membrane | Mitochondrion | Plastid | Endoplasmic reticulum | Lysosome vacuole | Golgi apparatus | Peroxisome |
---|---|---|---|---|---|---|---|---|---|---|---|
Cytoplasm|Nucleus | Nuclear localization signal | 0.6482 | 0.7246 | 0.0188 | 0.0205 | 0.381 | 0.0065 | 0.0183 | 0.0313 | 0.0173 | 0.0033 |
Orthofinder run ID | 4 |
Orthogroup | 4767 |
Change Orthofinder run |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Hirsu2|10062 MAPLPSNVHVSRHPCLQAKLSQLRSKMTGANDVKTLVHEIALVLACEALASNISAADGPKDHTPLGFEYTTTAAL PQTISIIPILRSGLAMVQAVQSILPRPVPVHHLGLYREQTTLDPVEYYNNLPSRNSSTGDTASSLAIVVDPVIAT GGTCTAAIQTLREWGAKKVVVLAIACAEDGVRRAASEWPDSTELWVAGMDQRLTHKGMLEPGLGDIGDRLFLTMG K* |
Coding | >Hirsu2|10062 ATGGCGCCGCTGCCGTCCAACGTCCACGTCTCGCGGCACCCGTGCCTCCAGGCCAAGCTGAGCCAGCTGCGCTCC AAGATGACGGGCGCCAACGACGTCAAGACGCTCGTCCACGAGATCGCCCTCGTCCTGGCCTGCGAGGCGCTCGCG TCCAACATCAGCGCCGCCGACGGGCCGAAGGATCATACGCCCCTGGGCTTCGAATACACCACGACGGCAGCCCTG CCGCAGACGATTTCCATCATCCCCATCCTGCGTTCCGGGCTCGCCATGGTACAAGCCGTCCAGTCCATCCTCCCC CGCCCCGTGCCCGTCCACCACCTCGGCCTGTACCGCGAGCAGACGACGCTCGACCCGGTCGAGTACTATAACAAC CTGCCCAGCCGCAACTCGTCCACGGGAGACACGGCCAGCTCCCTCGCCATTGTCGTCGACCCCGTCATCGCCACC GGCGGCACCTGCACCGCCGCCATCCAGACCCTCCGCGAGTGGGGCGCCAAGAAGGTCGTCGTTCTCGCAATCGCC TGCGCCGAGGACGGCGTCCGGAGGGCGGCCTCCGAGTGGCCCGACAGCACGGAGCTGTGGGTCGCCGGCATGGAC CAGCGCCTGACCCACAAGGGCATGCTGGAGCCGGGGCTGGGCGACATCGGCGACAGGCTGTTCCTGACCATGGGC AAGTAG |
Transcript | >Hirsu2|10062 ATGGCGCCGCTGCCGTCCAACGTCCACGTCTCGCGGCACCCGTGCCTCCAGGCCAAGCTGAGCCAGCTGCGCTCC AAGATGACGGGCGCCAACGACGTCAAGACGCTCGTCCACGAGATCGCCCTCGTCCTGGCCTGCGAGGCGCTCGCG TCCAACATCAGCGCCGCCGACGGGCCGAAGGATCATACGCCCCTGGGCTTCGAATACACCACGACGGCAGCCCTG CCGCAGACGATTTCCATCATCCCCATCCTGCGTTCCGGGCTCGCCATGGTACAAGCCGTCCAGTCCATCCTCCCC CGCCCCGTGCCCGTCCACCACCTCGGCCTGTACCGCGAGCAGACGACGCTCGACCCGGTCGAGTACTATAACAAC CTGCCCAGCCGCAACTCGTCCACGGGAGACACGGCCAGCTCCCTCGCCATTGTCGTCGACCCCGTCATCGCCACC GGCGGCACCTGCACCGCCGCCATCCAGACCCTCCGCGAGTGGGGCGCCAAGAAGGTCGTCGTTCTCGCAATCGCC TGCGCCGAGGACGGCGTCCGGAGGGCGGCCTCCGAGTGGCCCGACAGCACGGAGCTGTGGGTCGCCGGCATGGAC CAGCGCCTGACCCACAAGGGCATGCTGGAGCCGGGGCTGGGCGACATCGGCGACAGGCTGTTCCTGACCATGGGC AAGTAG |
Gene | >Hirsu2|10062 ATGGCGCCGCTGCCGTCCAACGTCCACGTCTCGCGGCACCCGTGCCTCCAGGCCAAGCTGAGCCAGCTGCGCTCC AAGATGACGGGCGCCAACGACGTCAAGACGCTCGTCCACGAGATCGCCCTCGTCCTGGCCTGCGAGGCGCTCGCG TCCAACATCAGCGCCGCCGACGGGCCGAAGGTGCGCGCGCCGTCACTTGGAGCTGCTTGTGCCTCGGACGGGGGC TGCTTCGTGCTGACGCCGTCGTCGTTGCAAGTAGGATCATACGCCCCTGGGCTTCGAATACACCACGACGGCAGC CCTGCCGCAGACGATTTCCATCATCCCCATCCTGCGTTCCGGGCTCGCCATGGTACAAGGTGCGCTGCCTCCGCC TCGTCGCCTCGTCGTCCAGGACGAAGAAGCTCGCCTGTCTCGGAAGCAGTGCTCTGACCCGCAACCTGCAGCCGT CCAGTCCATCCTCCCCCGCCCCGTGCCCGTCCACCACCTCGGCCTGTACCGCGAGCAGACGACGCTCGACCCGGT CGAGTACTATAACAACCTGCCCAGCCGCAACTCGTCCACGGGAGACACGGCCAGCTCCCTCGCCATTGTCGTCGA CCCCGTCATCGCCACCGGCGGCACCTGCACCGCCGCCATCCAGACCCTCCGCGAGTGGGGCGCCAAGAAGGTCGT CGTTCTCGCAATCGCCTGCGCCGAGGACGGCGTCCGGAGGGCGGCCTCCGAGTGGCCCGACAGCACGGAGCTGTG GGTCGCCGGCATGGACCAGCGCCTGACCCACAAGGGCATGCTGGAGCCGGGGCTGGGCGACATCGGCGACAGGCT GTTCCTGACCATGGGCAAGTAG |