Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10059
Gene name
LocationContig_780:9086..9999
Strand-
Gene length (bp)913
Transcript length (bp)849
Coding sequence length (bp)849
Protein length (aa) 283

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12589 WBS_methylT Methyltransferase involved in Williams-Beuren syndrome 1.9E-14 227 279
PF08241 Methyltransf_11 Methyltransferase domain 5.5E-11 52 161
PF13649 Methyltransf_25 Methyltransferase domain 7.6E-09 52 157
PF01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) 2.2E-04 29 89

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P25627|BUD23_YEAST 18S rRNA (guanine(1575)-N(7))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BUD23 PE=1 SV=1 1 282 6.0E-95
sp|Q9CY21|WBS22_MOUSE Probable 18S rRNA (guanine-N(7))-methyltransferase OS=Mus musculus GN=Wbscr22 PE=1 SV=1 3 282 1.0E-79
sp|Q55DA6|WBS22_DICDI Probable 18S rRNA (guanine-N(7))-methyltransferase OS=Dictyostelium discoideum GN=DDB_G0269722 PE=3 SV=1 1 282 4.0E-79
sp|O43709|WBS22_HUMAN Probable 18S rRNA (guanine-N(7))-methyltransferase OS=Homo sapiens GN=WBSCR22 PE=1 SV=2 3 282 2.0E-76
sp|Q10162|BUD23_SCHPO 18S rRNA (guanine-N(7))-methyltransferase bud23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bud23 PE=3 SV=1 1 282 4.0E-76
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P25627|BUD23_YEAST 18S rRNA (guanine(1575)-N(7))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BUD23 PE=1 SV=1 1 282 6.0E-95
sp|Q9CY21|WBS22_MOUSE Probable 18S rRNA (guanine-N(7))-methyltransferase OS=Mus musculus GN=Wbscr22 PE=1 SV=1 3 282 1.0E-79
sp|Q55DA6|WBS22_DICDI Probable 18S rRNA (guanine-N(7))-methyltransferase OS=Dictyostelium discoideum GN=DDB_G0269722 PE=3 SV=1 1 282 4.0E-79
sp|O43709|WBS22_HUMAN Probable 18S rRNA (guanine-N(7))-methyltransferase OS=Homo sapiens GN=WBSCR22 PE=1 SV=2 3 282 2.0E-76
sp|Q10162|BUD23_SCHPO 18S rRNA (guanine-N(7))-methyltransferase bud23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bud23 PE=3 SV=1 1 282 4.0E-76
sp|Q58DP0|WBS22_BOVIN Probable 18S rRNA (guanine-N(7))-methyltransferase OS=Bos taurus GN=WBSCR22 PE=2 SV=1 3 282 1.0E-73
[Show less]

GO

GO Term Description Terminal node
GO:0070476 rRNA (guanine-N7)-methylation Yes
GO:0016435 rRNA (guanine) methyltransferase activity Yes
GO:0008168 methyltransferase activity Yes
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0000154 rRNA modification No
GO:0032259 methylation No
GO:0016070 RNA metabolic process No
GO:0071704 organic substance metabolic process No
GO:0031167 rRNA methylation No
GO:0001510 RNA methylation No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0008173 RNA methyltransferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0008152 metabolic process No
GO:0036265 RNA (guanine-N7)-methylation No
GO:0008150 biological_process No
GO:0044260 cellular macromolecule metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0090304 nucleic acid metabolic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0009987 cellular process No
GO:0006396 RNA processing No
GO:0140102 catalytic activity, acting on a rRNA No
GO:0003824 catalytic activity No
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity No
GO:0043414 macromolecule methylation No
GO:0070475 rRNA base methylation No
GO:0034470 ncRNA processing No
GO:0009451 RNA modification No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008649 rRNA methyltransferase activity No
GO:0006364 rRNA processing No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0034660 ncRNA metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0016072 rRNA metabolic process No
GO:0043412 macromolecule modification No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10059
MSRPEDTLAADVHYDDAEARKYTTSSRIQTIQASMTRRALELLDLKRPSLLLDVGCGSGLSGEILSGLTRAEGGP
HAWVGMDLSASMLDVALQRDVEGDLLLADMGQGVPFRAGTFDAAISISALQWLCSAPSSDTAPAGRLARFFDGLY
AALRRGGRAVCQFYPRNDAQRDMITRAAVRAGFGAGILEDDPGTKNVKLYLVLTAGAGPADGHGPADITGVVAGM
DDVDVLDARRKLRPAGPAHMKKGSKAWIMKKKEQMERKGKVVKATSKYTGRKRRPAF*
Coding >Hirsu2|10059
ATGTCCCGCCCTGAGGATACGCTCGCGGCCGACGTGCACTACGACGACGCCGAGGCGCGCAAGTACACGACCAGC
TCGCGGATCCAGACGATTCAGGCGAGCATGACGCGGCGGGCGCTCGAGCTGCTGGACCTCAAGCGGCCGTCGCTC
CTGCTCGACGTCGGCTGCGGCAGCGGCCTCTCGGGCGAGATCCTGTCCGGGCTGACGCGGGCCGAGGGCGGCCCG
CACGCCTGGGTCGGCATGGACCTGTCGGCCTCGATGCTCGACGTGGCGCTGCAGCGCGACGTCGAGGGCGACCTG
CTGCTGGCCGACATGGGCCAGGGCGTGCCCTTCCGCGCCGGCACCTTCGACGCCGCCATCAGCATCTCCGCCCTG
CAGTGGCTGTGCAGCGCGCCCTCGTCCGACACCGCGCCCGCCGGTCGCCTGGCCCGCTTCTTCGACGGCCTCTAC
GCCGCCCTGCGCCGCGGCGGCCGCGCCGTCTGCCAGTTCTACCCCCGTAACGACGCCCAGCGCGATATGATCACC
CGCGCCGCCGTCCGCGCCGGCTTCGGCGCCGGCATCCTCGAGGACGACCCGGGCACCAAGAACGTCAAGCTCTAC
CTCGTCCTCACCGCCGGCGCAGGCCCCGCCGACGGGCACGGCCCCGCCGACATCACCGGCGTCGTCGCCGGCATG
GACGACGTCGACGTCCTCGACGCCCGCCGCAAGCTCAGGCCCGCCGGCCCCGCCCACATGAAGAAGGGCAGCAAG
GCCTGGATCATGAAGAAGAAGGAGCAGATGGAGCGCAAGGGCAAGGTCGTCAAGGCCACCTCCAAGTACACAGGC
CGCAAACGTCGCCCGGCCTTTTGA
Transcript >Hirsu2|10059
ATGTCCCGCCCTGAGGATACGCTCGCGGCCGACGTGCACTACGACGACGCCGAGGCGCGCAAGTACACGACCAGC
TCGCGGATCCAGACGATTCAGGCGAGCATGACGCGGCGGGCGCTCGAGCTGCTGGACCTCAAGCGGCCGTCGCTC
CTGCTCGACGTCGGCTGCGGCAGCGGCCTCTCGGGCGAGATCCTGTCCGGGCTGACGCGGGCCGAGGGCGGCCCG
CACGCCTGGGTCGGCATGGACCTGTCGGCCTCGATGCTCGACGTGGCGCTGCAGCGCGACGTCGAGGGCGACCTG
CTGCTGGCCGACATGGGCCAGGGCGTGCCCTTCCGCGCCGGCACCTTCGACGCCGCCATCAGCATCTCCGCCCTG
CAGTGGCTGTGCAGCGCGCCCTCGTCCGACACCGCGCCCGCCGGTCGCCTGGCCCGCTTCTTCGACGGCCTCTAC
GCCGCCCTGCGCCGCGGCGGCCGCGCCGTCTGCCAGTTCTACCCCCGTAACGACGCCCAGCGCGATATGATCACC
CGCGCCGCCGTCCGCGCCGGCTTCGGCGCCGGCATCCTCGAGGACGACCCGGGCACCAAGAACGTCAAGCTCTAC
CTCGTCCTCACCGCCGGCGCAGGCCCCGCCGACGGGCACGGCCCCGCCGACATCACCGGCGTCGTCGCCGGCATG
GACGACGTCGACGTCCTCGACGCCCGCCGCAAGCTCAGGCCCGCCGGCCCCGCCCACATGAAGAAGGGCAGCAAG
GCCTGGATCATGAAGAAGAAGGAGCAGATGGAGCGCAAGGGCAAGGTCGTCAAGGCCACCTCCAAGTACACAGGC
CGCAAACGTCGCCCGGCCTTTTGA
Gene >Hirsu2|10059
ATGTCCCGCCCTGAGGATACGCTGTAAGTCGGTCGACCGTCGCCCTCTCGGTCCGCCTCCTTGGCTGACCATGTG
CTCGCTCCCCAGCGCGGCCGACGTGCACTACGACGACGCCGAGGCGCGCAAGTACACGACCAGCTCGCGGATCCA
GACGATTCAGGCGAGCATGACGCGGCGGGCGCTCGAGCTGCTGGACCTCAAGCGGCCGTCGCTCCTGCTCGACGT
CGGCTGCGGCAGCGGCCTCTCGGGCGAGATCCTGTCCGGGCTGACGCGGGCCGAGGGCGGCCCGCACGCCTGGGT
CGGCATGGACCTGTCGGCCTCGATGCTCGACGTGGCGCTGCAGCGCGACGTCGAGGGCGACCTGCTGCTGGCCGA
CATGGGCCAGGGCGTGCCCTTCCGCGCCGGCACCTTCGACGCCGCCATCAGCATCTCCGCCCTGCAGTGGCTGTG
CAGCGCGCCCTCGTCCGACACCGCGCCCGCCGGTCGCCTGGCCCGCTTCTTCGACGGCCTCTACGCCGCCCTGCG
CCGCGGCGGCCGCGCCGTCTGCCAGTTCTACCCCCGTAACGACGCCCAGCGCGATATGATCACCCGCGCCGCCGT
CCGCGCCGGCTTCGGCGCCGGCATCCTCGAGGACGACCCGGGCACCAAGAACGTCAAGCTCTACCTCGTCCTCAC
CGCCGGCGCAGGCCCCGCCGACGGGCACGGCCCCGCCGACATCACCGGCGTCGTCGCCGGCATGGACGACGTCGA
CGTCCTCGACGCCCGCCGCAAGCTCAGGCCCGCCGGCCCCGCCCACATGAAGAAGGGCAGCAAGGCCTGGATCAT
GAAGAAGAAGGAGCAGATGGAGCGCAAGGGCAAGGTCGTCAAGGCCACCTCCAAGTACACAGGCCGCAAACGTCG
CCCGGCCTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail