Protein ID | Hirsu2|10052 |
Gene name | |
Location | Contig_78:37037..39236 |
Strand | - |
Gene length (bp) | 2199 |
Transcript length (bp) | 1881 |
Coding sequence length (bp) | 1881 |
Protein length (aa) | 627 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF00009 | GTP_EFTU | Elongation factor Tu GTP binding domain | 5.5E-18 | 191 | 412 |
PF03144 | GTP_EFTU_D2 | Elongation factor Tu domain 2 | 2.2E-08 | 437 | 507 |
PF03143 | GTP_EFTU_D3 | Elongation factor Tu C-terminal domain | 1.1E-05 | 519 | 589 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q58DC5|GTPB1_BOVIN | GTP-binding protein 1 OS=Bos taurus GN=GTPBP1 PE=2 SV=2 | 78 | 616 | 1.0E-171 |
sp|O08582|GTPB1_MOUSE | GTP-binding protein 1 OS=Mus musculus GN=Gtpbp1 PE=1 SV=2 | 78 | 616 | 2.0E-171 |
sp|D2XV59|GTPB1_RAT | GTP-binding protein 1 OS=Rattus norvegicus GN=Gtpbp1 PE=1 SV=1 | 78 | 616 | 2.0E-171 |
sp|O00178|GTPB1_HUMAN | GTP-binding protein 1 OS=Homo sapiens GN=GTPBP1 PE=1 SV=3 | 78 | 616 | 3.0E-171 |
sp|Q5R8Q7|GTPB1_PONAB | GTP-binding protein 1 (Fragment) OS=Pongo abelii GN=GTPBP1 PE=2 SV=2 | 98 | 616 | 2.0E-170 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q58DC5|GTPB1_BOVIN | GTP-binding protein 1 OS=Bos taurus GN=GTPBP1 PE=2 SV=2 | 78 | 616 | 1.0E-171 |
sp|O08582|GTPB1_MOUSE | GTP-binding protein 1 OS=Mus musculus GN=Gtpbp1 PE=1 SV=2 | 78 | 616 | 2.0E-171 |
sp|D2XV59|GTPB1_RAT | GTP-binding protein 1 OS=Rattus norvegicus GN=Gtpbp1 PE=1 SV=1 | 78 | 616 | 2.0E-171 |
sp|O00178|GTPB1_HUMAN | GTP-binding protein 1 OS=Homo sapiens GN=GTPBP1 PE=1 SV=3 | 78 | 616 | 3.0E-171 |
sp|Q5R8Q7|GTPB1_PONAB | GTP-binding protein 1 (Fragment) OS=Pongo abelii GN=GTPBP1 PE=2 SV=2 | 98 | 616 | 2.0E-170 |
sp|Q5XGS8|GTPB1_XENLA | GTP-binding protein 1 OS=Xenopus laevis GN=gtpbp1 PE=2 SV=1 | 78 | 616 | 4.0E-160 |
sp|Q18905|CGP1_CAEEL | GTP-binding protein cgp-1 OS=Caenorhabditis elegans GN=cgp-1 PE=2 SV=2 | 80 | 624 | 3.0E-151 |
sp|Q17045|AGP1_ASCSU | GTP-binding protein AGP-1 OS=Ascaris suum GN=AGP-1 PE=2 SV=1 | 84 | 624 | 2.0E-147 |
sp|Q3UJK4|GTPB2_MOUSE | GTP-binding protein 2 OS=Mus musculus GN=Gtpbp2 PE=1 SV=1 | 99 | 604 | 2.0E-132 |
sp|Q9BX10|GTPB2_HUMAN | GTP-binding protein 2 OS=Homo sapiens GN=GTPBP2 PE=1 SV=1 | 99 | 604 | 2.0E-132 |
sp|Q5UR72|YR624_MIMIV | Putative GTP-binding protein R624 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R624 PE=3 SV=1 | 168 | 603 | 2.0E-53 |
sp|P35021|EF1A_SULSO | Elongation factor 1-alpha OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=tuf PE=1 SV=3 | 192 | 608 | 2.0E-23 |
sp|Q18EY5|EF1A_HALWD | Elongation factor 1-alpha OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=tuf PE=3 SV=1 | 186 | 588 | 5.0E-23 |
sp|Q3IUD8|EF1A_NATPD | Elongation factor 1-alpha OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=tuf PE=3 SV=1 | 184 | 579 | 5.0E-23 |
sp|A8MAJ1|EF1A_CALMQ | Elongation factor 1-alpha OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=tuf PE=3 SV=1 | 192 | 591 | 6.0E-22 |
sp|P16018|EF1A_HALMA | Elongation factor 1-alpha OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=tuf PE=1 SV=2 | 186 | 618 | 1.0E-21 |
sp|Q57770|EF1A_METJA | Elongation factor 1-alpha OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=tuf PE=3 SV=1 | 192 | 600 | 6.0E-21 |
sp|Q8TYP6|EF1A_METKA | Elongation factor 1-alpha OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=tuf PE=3 SV=1 | 192 | 609 | 9.0E-21 |
sp|A4YCR6|EF1A_METS5 | Elongation factor 1-alpha OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=tuf PE=3 SV=1 | 192 | 608 | 1.0E-20 |
sp|Q8TRC4|EF1A_METAC | Elongation factor 1-alpha OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=tuf PE=3 SV=1 | 184 | 609 | 1.0E-20 |
sp|A3DMQ1|EF1A_STAMF | Elongation factor 1-alpha OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=tuf PE=3 SV=1 | 192 | 608 | 1.0E-20 |
sp|Q9HM89|EF1A_HALSA | Elongation factor 1-alpha OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=tuf PE=3 SV=1 | 191 | 588 | 3.0E-20 |
sp|B0R8C3|EF1A_HALS3 | Elongation factor 1-alpha OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=tuf PE=3 SV=1 | 191 | 588 | 3.0E-20 |
sp|P17196|EF1A_SULAC | Elongation factor 1-alpha OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=tuf PE=3 SV=1 | 192 | 601 | 3.0E-20 |
sp|A3MV69|EF1A_PYRCJ | Elongation factor 1-alpha OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=tuf PE=3 SV=1 | 192 | 586 | 6.0E-20 |
sp|A1RRJ3|EF1A_PYRIL | Elongation factor 1-alpha OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=tuf PE=3 SV=1 | 192 | 586 | 7.0E-20 |
sp|A4WKK8|EF1A_PYRAR | Elongation factor 1-alpha OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=tuf PE=3 SV=1 | 192 | 586 | 7.0E-20 |
sp|O93729|EF1A_PYRAE | Elongation factor 1-alpha OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=tuf PE=3 SV=1 | 192 | 586 | 1.0E-19 |
sp|A8ABM5|EF1A_IGNH4 | Elongation factor 1-alpha OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=tuf PE=3 SV=1 | 192 | 604 | 8.0E-19 |
sp|Q976B1|EF1A_SULTO | Elongation factor 1-alpha OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=tuf PE=3 SV=1 | 192 | 602 | 9.0E-19 |
sp|Q8PUR8|EF1A_METMA | Elongation factor 1-alpha OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=tuf PE=3 SV=1 | 184 | 609 | 2.0E-18 |
sp|A7I656|EF1A_METB6 | Elongation factor 1-alpha OS=Methanoregula boonei (strain 6A8) GN=tuf PE=3 SV=1 | 184 | 609 | 2.0E-18 |
sp|Q9YIC0|EF1A_ORYLA | Elongation factor 1-alpha OS=Oryzias latipes GN=eef1a PE=2 SV=1 | 185 | 616 | 3.0E-18 |
sp|A5ULM5|EF1A_METS3 | Elongation factor 1-alpha OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=tuf PE=3 SV=2 | 191 | 603 | 7.0E-18 |
sp|A6UV43|EF1A_META3 | Elongation factor 1-alpha OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=tuf PE=3 SV=1 | 191 | 609 | 8.0E-18 |
sp|Q0W8G2|EF1A_METAR | Elongation factor 1-alpha OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=tuf PE=3 SV=1 | 192 | 586 | 1.0E-17 |
sp|C6A4R7|EF1A_THESM | Elongation factor 1-alpha OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=tuf PE=3 SV=1 | 184 | 574 | 1.0E-17 |
sp|Q6L202|EF1A_PICTO | Elongation factor 1-alpha OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=tuf PE=3 SV=1 | 184 | 609 | 2.0E-17 |
sp|P33165|EFTU_BACFR | Elongation factor Tu OS=Bacteroides fragilis (strain YCH46) GN=tuf PE=3 SV=1 | 243 | 604 | 4.0E-17 |
sp|Q5L890|EFTU_BACFN | Elongation factor Tu OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=tuf PE=3 SV=1 | 243 | 604 | 4.0E-17 |
sp|A2STF0|EF1A_METLZ | Elongation factor 1-alpha OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=tuf PE=3 SV=1 | 192 | 586 | 7.0E-17 |
sp|Q8A463|EFTU_BACTN | Elongation factor Tu OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=tuf PE=3 SV=1 | 243 | 604 | 7.0E-17 |
sp|O29325|EF1A_ARCFU | Elongation factor 1-alpha OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=tuf PE=3 SV=1 | 184 | 600 | 7.0E-17 |
sp|A2BN41|EF1A_HYPBU | Elongation factor 1-alpha OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=tuf PE=3 SV=1 | 276 | 601 | 8.0E-17 |
sp|Q464Z4|EF1A_METBF | Elongation factor 1-alpha OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=tuf PE=3 SV=1 | 184 | 609 | 1.0E-16 |
sp|A6VGV6|EF1A_METM7 | Elongation factor 1-alpha OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=tuf PE=3 SV=1 | 192 | 609 | 1.0E-16 |
sp|P29520|EF1A_BOMMO | Elongation factor 1-alpha OS=Bombyx mori PE=2 SV=1 | 192 | 606 | 2.0E-16 |
sp|A4FWE9|EF1A_METM5 | Elongation factor 1-alpha OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=tuf PE=3 SV=1 | 191 | 609 | 2.0E-16 |
sp|A8GPF2|EFTU_RICAH | Elongation factor Tu OS=Rickettsia akari (strain Hartford) GN=tuf PE=3 SV=1 | 280 | 604 | 3.0E-16 |
sp|A0RUM4|EF1A_CENSY | Elongation factor 1-alpha OS=Cenarchaeum symbiosum (strain A) GN=tuf PE=3 SV=1 | 186 | 591 | 3.0E-16 |
sp|Q9YAV0|EF1A_AERPE | Elongation factor 1-alpha OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=tuf PE=1 SV=1 | 192 | 602 | 3.0E-16 |
sp|Q6LXI1|EF1A_METMP | Elongation factor 1-alpha OS=Methanococcus maripaludis (strain S2 / LL) GN=tuf PE=3 SV=1 | 191 | 609 | 4.0E-16 |
sp|B8GIQ3|EF1A_METPE | Elongation factor 1-alpha OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=tuf PE=3 SV=1 | 184 | 609 | 4.0E-16 |
sp|P51554|EF1A_HYDVU | Elongation factor 1-alpha OS=Hydra vulgaris PE=2 SV=1 | 192 | 604 | 5.0E-16 |
sp|P53013|EF1A_CAEEL | Elongation factor 1-alpha OS=Caenorhabditis elegans GN=eft-3 PE=3 SV=1 | 184 | 608 | 5.0E-16 |
sp|P41203|EF1A_DESMO | Elongation factor 1-alpha OS=Desulfurococcus mobilis GN=tuf PE=3 SV=1 | 192 | 613 | 7.0E-16 |
sp|Q979T1|EF1A_THEVO | Elongation factor 1-alpha OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=tuf PE=3 SV=2 | 192 | 613 | 9.0E-16 |
sp|P08736|EF1A1_DROME | Elongation factor 1-alpha 1 OS=Drosophila melanogaster GN=Ef1alpha48D PE=1 SV=2 | 185 | 586 | 9.0E-16 |
sp|Q2HJN6|EF1A3_OSCTI | Elongation factor 1-alpha 3 OS=Oscheius tipulae GN=eft-3 PE=3 SV=1 | 186 | 586 | 9.0E-16 |
sp|P86939|EF1A2_TRYB2 | Elongation factor 1-alpha 2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=Tb10.70.5670 PE=1 SV=1 | 185 | 604 | 9.0E-16 |
sp|P86934|EF1A1_TRYB2 | Elongation factor 1-alpha 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=TEF1 PE=1 SV=1 | 185 | 604 | 9.0E-16 |
sp|A6UQ14|EF1A_METVS | Elongation factor 1-alpha OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=tuf PE=3 SV=1 | 192 | 609 | 1.0E-15 |
sp|P19486|EF1A_THEAC | Elongation factor 1-alpha OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=tuf PE=3 SV=2 | 192 | 613 | 1.0E-15 |
sp|A9A9U3|EF1A_METM6 | Elongation factor 1-alpha OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=tuf PE=3 SV=1 | 192 | 609 | 1.0E-15 |
sp|A0B7D6|EF1A_METTP | Elongation factor 1-alpha OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=tuf PE=3 SV=1 | 192 | 602 | 2.0E-15 |
sp|P07810|EF1A_METVA | Elongation factor 1-alpha OS=Methanococcus vannielii GN=tuf PE=3 SV=1 | 192 | 609 | 5.0E-15 |
sp|A1RXW9|EF1A_THEPD | Elongation factor 1-alpha OS=Thermofilum pendens (strain Hrk 5) GN=tuf PE=3 SV=1 | 192 | 591 | 5.0E-15 |
sp|Q8BFR5|EFTU_MOUSE | Elongation factor Tu, mitochondrial OS=Mus musculus GN=Tufm PE=1 SV=1 | 186 | 604 | 5.0E-15 |
sp|Q2HJN8|EF1A2_OSCTI | Elongation factor 1-alpha 2 OS=Oscheius tipulae GN=eft-2 PE=3 SV=1 | 192 | 608 | 8.0E-15 |
sp|P13549|EF1A0_XENLA | Elongation factor 1-alpha, somatic form OS=Xenopus laevis GN=eef1as PE=2 SV=1 | 192 | 586 | 8.0E-15 |
sp|Q26487|EF1A_SPOFR | Elongation factor 1-alpha (Fragment) OS=Spodoptera frugiperda PE=1 SV=1 | 276 | 586 | 9.0E-15 |
sp|Q2HJN4|EF1A1_OSCTI | Elongation factor 1-alpha 1 OS=Oscheius tipulae GN=eft-1 PE=3 SV=1 | 192 | 608 | 1.0E-14 |
sp|A8Z5T8|EFTU_SULMW | Elongation factor Tu OS=Sulcia muelleri (strain GWSS) GN=tuf PE=3 SV=1 | 280 | 601 | 1.0E-14 |
sp|B6YQ04|EFTU_AZOPC | Elongation factor Tu OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=tuf PE=3 SV=1 | 280 | 604 | 1.0E-14 |
sp|A8F2E9|EFTU_RICM5 | Elongation factor Tu OS=Rickettsia massiliae (strain Mtu5) GN=tuf PE=3 SV=2 | 280 | 604 | 1.0E-14 |
sp|Q90835|EF1A_CHICK | Elongation factor 1-alpha 1 OS=Gallus gallus GN=EEF1A PE=2 SV=1 | 192 | 586 | 1.0E-14 |
sp|P0CN30|EF1A_CRYNJ | Elongation factor 1-alpha OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TEF1 PE=3 SV=1 | 184 | 608 | 1.0E-14 |
sp|P0CN31|EF1A_CRYNB | Elongation factor 1-alpha OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TEF1 PE=2 SV=1 | 184 | 608 | 1.0E-14 |
sp|P02993|EF1A_ARTSA | Elongation factor 1-alpha OS=Artemia salina PE=1 SV=2 | 185 | 586 | 1.0E-14 |
sp|P68105|EF1A1_RABIT | Elongation factor 1-alpha 1 OS=Oryctolagus cuniculus GN=EEF1A1 PE=1 SV=1 | 192 | 586 | 1.0E-14 |
sp|Q5R4R8|EF1A1_PONAB | Elongation factor 1-alpha 1 OS=Pongo abelii GN=EEF1A1 PE=2 SV=2 | 192 | 586 | 1.0E-14 |
sp|Q5R1X2|EF1A1_PANTR | Elongation factor 1-alpha 1 OS=Pan troglodytes GN=EEF1A1 PE=2 SV=1 | 192 | 586 | 1.0E-14 |
sp|P68104|EF1A1_HUMAN | Elongation factor 1-alpha 1 OS=Homo sapiens GN=EEF1A1 PE=1 SV=1 | 192 | 586 | 1.0E-14 |
sp|Q66RN5|EF1A1_FELCA | Elongation factor 1-alpha 1 OS=Felis catus GN=EEF1A1 PE=2 SV=1 | 192 | 586 | 1.0E-14 |
sp|P68103|EF1A1_BOVIN | Elongation factor 1-alpha 1 OS=Bos taurus GN=EEF1A1 PE=1 SV=1 | 192 | 586 | 1.0E-14 |
sp|P62630|EF1A1_RAT | Elongation factor 1-alpha 1 OS=Rattus norvegicus GN=Eef1a1 PE=2 SV=1 | 192 | 586 | 2.0E-14 |
sp|P10126|EF1A1_MOUSE | Elongation factor 1-alpha 1 OS=Mus musculus GN=Eef1a1 PE=1 SV=3 | 192 | 586 | 2.0E-14 |
sp|P62629|EF1A1_CRIGR | Elongation factor 1-alpha 1 OS=Cricetulus griseus GN=EEF1A1 PE=2 SV=1 | 192 | 586 | 2.0E-14 |
sp|P85834|EFTU_RAT | Elongation factor Tu, mitochondrial OS=Rattus norvegicus GN=Tufm PE=1 SV=1 | 186 | 604 | 2.0E-14 |
sp|Q2HJN9|EF1A4_OSCTI | Elongation factor 1-alpha 4 OS=Oscheius tipulae GN=eft-4 PE=3 SV=1 | 192 | 608 | 2.0E-14 |
sp|P14963|EF1A_EUGGR | Elongation factor 1-alpha OS=Euglena gracilis GN=TEF PE=2 SV=1 | 184 | 608 | 2.0E-14 |
sp|A6KYK9|EFTU_BACV8 | Elongation factor Tu OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=tuf PE=3 SV=1 | 243 | 599 | 2.0E-14 |
sp|Q92GW4|EFTU_RICCN | Elongation factor Tu OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=tuf PE=3 SV=1 | 280 | 604 | 2.0E-14 |
sp|P34825|EF1A_HYPJE | Elongation factor 1-alpha OS=Hypocrea jecorina GN=tef1 PE=3 SV=1 | 185 | 608 | 2.0E-14 |
sp|Q2FRI3|EF1A_METHJ | Elongation factor 1-alpha OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=tuf PE=3 SV=1 | 192 | 603 | 2.0E-14 |
sp|Q01372|EF1A_NEUCR | Elongation factor 1-alpha OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tef-1 PE=3 SV=2 | 185 | 608 | 2.0E-14 |
sp|P05303|EF1A2_DROME | Elongation factor 1-alpha 2 OS=Drosophila melanogaster GN=Ef1alpha100E PE=2 SV=2 | 184 | 606 | 2.0E-14 |
sp|P0CT32|EF1A2_DICDI | Elongation factor 1-alpha OS=Dictyostelium discoideum GN=eef1a2 PE=1 SV=1 | 192 | 566 | 2.0E-14 |
sp|P0CT31|EF1A1_DICDI | Elongation factor 1-alpha OS=Dictyostelium discoideum GN=eef1a1 PE=1 SV=1 | 192 | 566 | 2.0E-14 |
sp|Q9Y713|EF1A_ASPOR | Elongation factor 1-alpha OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tef1 PE=3 SV=1 | 185 | 591 | 2.0E-14 |
sp|Q09069|EF1A_SORMA | Elongation factor 1-alpha OS=Sordaria macrospora GN=TEF PE=3 SV=1 | 185 | 608 | 2.0E-14 |
sp|A8GT71|EFTU_RICRS | Elongation factor Tu OS=Rickettsia rickettsii (strain Sheila Smith) GN=tuf PE=3 SV=1 | 280 | 604 | 3.0E-14 |
sp|B0BUR2|EFTU_RICRO | Elongation factor Tu OS=Rickettsia rickettsii (strain Iowa) GN=tuf PE=3 SV=1 | 280 | 604 | 3.0E-14 |
sp|C4K2I2|EFTU_RICPU | Elongation factor Tu OS=Rickettsia peacockii (strain Rustic) GN=tuf PE=3 SV=1 | 280 | 604 | 3.0E-14 |
sp|C3PPA9|EFTU_RICAE | Elongation factor Tu OS=Rickettsia africae (strain ESF-5) GN=tuf PE=3 SV=1 | 280 | 604 | 3.0E-14 |
sp|A6LLL1|EFTU_THEM4 | Elongation factor Tu OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=tuf PE=3 SV=1 | 280 | 604 | 3.0E-14 |
sp|Q5VTE0|EF1A3_HUMAN | Putative elongation factor 1-alpha-like 3 OS=Homo sapiens GN=EEF1A1P5 PE=5 SV=1 | 192 | 586 | 3.0E-14 |
sp|A3CTG3|EF1A_METMJ | Elongation factor 1-alpha OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=tuf PE=3 SV=1 | 192 | 609 | 3.0E-14 |
sp|P43927|SELB_HAEIN | Selenocysteine-specific elongation factor OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=selB PE=3 SV=1 | 274 | 598 | 3.0E-14 |
sp|P48865|EFTU_RICPR | Elongation factor Tu OS=Rickettsia prowazekii (strain Madrid E) GN=tuf PE=3 SV=2 | 280 | 604 | 4.0E-14 |
sp|Q8KT95|EFTU_RICTY | Elongation factor Tu OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=tuf PE=3 SV=2 | 280 | 601 | 4.0E-14 |
sp|P17508|EF1A3_XENLA | Elongation factor 1-alpha, oocyte form OS=Xenopus laevis PE=1 SV=2 | 184 | 586 | 5.0E-14 |
sp|O27132|EF1A_METTH | Elongation factor 1-alpha OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=tuf PE=1 SV=1 | 184 | 602 | 5.0E-14 |
sp|P0A3B0|EFTU_RICSI | Elongation factor Tu OS=Rickettsia sibirica GN=tuf PE=3 SV=1 | 280 | 604 | 5.0E-14 |
sp|P0A3A9|EFTU_RICRI | Elongation factor Tu OS=Rickettsia rickettsii GN=tuf PE=3 SV=1 | 280 | 604 | 5.0E-14 |
sp|P86933|EF1A_TRYBB | Elongation factor 1-alpha OS=Trypanosoma brucei brucei GN=TEF1 PE=2 SV=1 | 185 | 604 | 6.0E-14 |
sp|Q04634|EF1A_TETPY | Elongation factor 1-alpha OS=Tetrahymena pyriformis PE=2 SV=1 | 186 | 608 | 6.0E-14 |
sp|B3QY22|EFTU_CHLT3 | Elongation factor Tu OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=tuf PE=3 SV=1 | 192 | 604 | 7.0E-14 |
sp|Q8KT99|EFTU_RICHE | Elongation factor Tu OS=Rickettsia helvetica GN=tuf PE=3 SV=1 | 280 | 604 | 7.0E-14 |
sp|A8EZL8|EFTU_RICCK | Elongation factor Tu OS=Rickettsia canadensis (strain McKiel) GN=tuf PE=3 SV=1 | 280 | 604 | 7.0E-14 |
sp|P19039|EF1A_APIME | Elongation factor 1-alpha OS=Apis mellifera PE=3 SV=1 | 185 | 606 | 8.0E-14 |
sp|Q01765|EF1A_PODCU | Elongation factor 1-alpha OS=Podospora curvicolla GN=TEF PE=3 SV=1 | 185 | 608 | 8.0E-14 |
sp|Q2NEL1|EF1A_METST | Elongation factor 1-alpha OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=tuf PE=3 SV=1 | 184 | 600 | 8.0E-14 |
sp|P62632|EF1A2_RAT | Elongation factor 1-alpha 2 OS=Rattus norvegicus GN=Eef1a2 PE=1 SV=1 | 192 | 586 | 1.0E-13 |
sp|P62631|EF1A2_MOUSE | Elongation factor 1-alpha 2 OS=Mus musculus GN=Eef1a2 PE=1 SV=1 | 192 | 586 | 1.0E-13 |
sp|Q92005|EF1A_DANRE | Elongation factor 1-alpha OS=Danio rerio GN=eef1a PE=2 SV=1 | 192 | 586 | 1.0E-13 |
sp|P84316|EF1A_HELZE | Elongation factor 1-alpha (Fragment) OS=Helicoverpa zea PE=3 SV=1 | 276 | 586 | 1.0E-13 |
sp|P84315|EF1A_HELVI | Elongation factor 1-alpha (Fragment) OS=Heliothis virescens PE=3 SV=1 | 276 | 586 | 1.0E-13 |
sp|P84318|EF1A_HELGL | Elongation factor 1-alpha (Fragment) OS=Helicoverpa gelotopoeon PE=3 SV=1 | 276 | 586 | 1.0E-13 |
sp|P84320|EF1A_HELDI | Elongation factor 1-alpha (Fragment) OS=Heliocheilus discalis PE=3 SV=1 | 276 | 586 | 1.0E-13 |
sp|P84317|EF1A_HELAM | Elongation factor 1-alpha (Fragment) OS=Helicoverpa armigera PE=3 SV=1 | 276 | 586 | 1.0E-13 |
sp|P84319|EF1A_HELAL | Elongation factor 1-alpha (Fragment) OS=Heliocheilus albipunctella PE=3 SV=1 | 276 | 586 | 1.0E-13 |
sp|P84322|EF1A_ANIIF | Elongation factor 1-alpha (Fragment) OS=Anicla infecta PE=3 SV=1 | 276 | 586 | 1.0E-13 |
sp|P84321|EF1A_ADIBE | Elongation factor 1-alpha (Fragment) OS=Adisura bella PE=3 SV=1 | 276 | 586 | 1.0E-13 |
sp|P49410|EFTU_BOVIN | Elongation factor Tu, mitochondrial OS=Bos taurus GN=TUFM PE=1 SV=1 | 186 | 601 | 1.0E-13 |
sp|Q01520|EF1A_PODAS | Elongation factor 1-alpha OS=Podospora anserina GN=TEF PE=3 SV=1 | 185 | 608 | 1.0E-13 |
sp|Q71V39|EF1A2_RABIT | Elongation factor 1-alpha 2 OS=Oryctolagus cuniculus GN=EEF1A2 PE=1 SV=1 | 192 | 586 | 1.0E-13 |
sp|Q05639|EF1A2_HUMAN | Elongation factor 1-alpha 2 OS=Homo sapiens GN=EEF1A2 PE=1 SV=1 | 192 | 586 | 1.0E-13 |
sp|Q32PH8|EF1A2_BOVIN | Elongation factor 1-alpha 2 OS=Bos taurus GN=EEF1A2 PE=2 SV=1 | 192 | 586 | 1.0E-13 |
sp|A2Q0Z0|EF1A1_HORSE | Elongation factor 1-alpha 1 OS=Equus caballus GN=EEF1A1 PE=2 SV=1 | 192 | 586 | 1.0E-13 |
sp|A9BHA7|EFTU_PETMO | Elongation factor Tu OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=tuf PE=3 SV=1 | 280 | 604 | 1.0E-13 |
sp|Q8U152|EF1A_PYRFU | Elongation factor 1-alpha OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=tuf PE=3 SV=1 | 185 | 584 | 2.0E-13 |
sp|P17507|EF1A2_XENLA | Elongation factor 1-alpha, oocyte form OS=Xenopus laevis GN=eef1ao PE=1 SV=1 | 184 | 586 | 2.0E-13 |
sp|Q9V0V7|EF1A_PYRAB | Elongation factor 1-alpha OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=tuf PE=3 SV=1 | 192 | 588 | 2.0E-13 |
sp|P26751|EF1A_PYRWO | Elongation factor 1-alpha OS=Pyrococcus woesei GN=tuf PE=3 SV=1 | 185 | 584 | 2.0E-13 |
sp|Q9Y700|EFTU_SCHPO | Elongation factor Tu, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tuf1 PE=3 SV=1 | 162 | 593 | 2.0E-13 |
sp|Q8KTA3|EFTU_RICRH | Elongation factor Tu OS=Rickettsia rhipicephali GN=tuf PE=3 SV=1 | 280 | 604 | 2.0E-13 |
sp|C5CGR6|EFTU_KOSOT | Elongation factor Tu OS=Kosmotoga olearia (strain TBF 19.5.1) GN=tuf PE=3 SV=1 | 280 | 604 | 2.0E-13 |
sp|B2RL52|EFTU_PORG3 | Elongation factor Tu OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=tuf PE=3 SV=1 | 243 | 599 | 2.0E-13 |
sp|Q46455|SELB_MOOTH | Selenocysteine-specific elongation factor OS=Moorella thermoacetica GN=selB PE=1 SV=1 | 192 | 591 | 2.0E-13 |
sp|O59153|EF1A_PYRHO | Elongation factor 1-alpha OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=tuf PE=1 SV=1 | 192 | 584 | 2.0E-13 |
sp|Q1LSY4|EFTU_BAUCH | Elongation factor Tu OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=tuf PE=3 SV=1 | 280 | 604 | 2.0E-13 |
sp|P49411|EFTU_HUMAN | Elongation factor Tu, mitochondrial OS=Homo sapiens GN=TUFM PE=1 SV=2 | 186 | 601 | 2.0E-13 |
sp|A5FIJ9|EFTU_FLAJ1 | Elongation factor Tu OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=tuf PE=3 SV=1 | 192 | 604 | 2.0E-13 |
sp|B7IHU4|EFTU_THEAB | Elongation factor Tu OS=Thermosipho africanus (strain TCF52B) GN=tuf PE=3 SV=1 | 280 | 604 | 2.0E-13 |
sp|Q8LPC4|EF1A_PYRYE | Elongation factor 1-alpha OS=Pyropia yezoensis PE=2 SV=1 | 192 | 604 | 3.0E-13 |
sp|Q2GJ61|EFTU_ANAPZ | Elongation factor Tu OS=Anaplasma phagocytophilum (strain HZ) GN=tuf1 PE=3 SV=1 | 263 | 604 | 3.0E-13 |
sp|Q5JFZ4|EF1A_THEKO | Elongation factor 1-alpha OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=tuf PE=3 SV=1 | 184 | 574 | 4.0E-13 |
sp|P32186|EF1A_PUCGR | Elongation factor 1-alpha OS=Puccinia graminis GN=TEF PE=3 SV=2 | 192 | 608 | 4.0E-13 |
sp|C5A5P4|EF1A_THEGJ | Elongation factor 1-alpha OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=tuf PE=3 SV=1 | 184 | 574 | 4.0E-13 |
sp|Q8KTA6|EFTU_RICPA | Elongation factor Tu OS=Rickettsia parkeri GN=tuf PE=3 SV=1 | 280 | 604 | 5.0E-13 |
sp|Q8KTA1|EFTU_RICMO | Elongation factor Tu OS=Rickettsia montanensis GN=tuf PE=3 SV=1 | 280 | 604 | 5.0E-13 |
sp|A6GYU7|EFTU_FLAPJ | Elongation factor Tu OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=tuf PE=3 SV=1 | 192 | 604 | 5.0E-13 |
sp|B9KFF9|EFTU_CAMLR | Elongation factor Tu OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=tuf PE=3 SV=1 | 280 | 604 | 7.0E-13 |
sp|B9K884|EFTU_THENN | Elongation factor Tu OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=tuf PE=3 SV=1 | 280 | 604 | 7.0E-13 |
sp|P17197|EF1A_THECE | Elongation factor 1-alpha OS=Thermococcus celer GN=tuf PE=3 SV=1 | 184 | 574 | 8.0E-13 |
sp|Q5GSU2|EFTU1_WOLTR | Elongation factor Tu 1 OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=tuf1 PE=3 SV=1 | 280 | 604 | 8.0E-13 |
sp|Q5PBH1|EFTU_ANAMM | Elongation factor Tu OS=Anaplasma marginale (strain St. Maries) GN=tuf1 PE=3 SV=1 | 263 | 604 | 8.0E-13 |
sp|Q5GRY3|EFTU2_WOLTR | Elongation factor Tu 2 OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=tuf2 PE=3 SV=1 | 280 | 604 | 9.0E-13 |
sp|P40911|EF1A_AJECG | Elongation factor 1-alpha OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=TEF PE=2 SV=1 | 185 | 608 | 9.0E-13 |
sp|Q8KT97|EFTU_RICFE | Elongation factor Tu OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=tuf PE=3 SV=1 | 280 | 604 | 1.0E-12 |
sp|Q59QD6|EF1A2_CANAL | Elongation factor 1-alpha 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TEF2 PE=3 SV=1 | 192 | 608 | 1.0E-12 |
sp|P50068|EFTU_UREPA | Elongation factor Tu OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=tuf PE=3 SV=1 | 280 | 601 | 1.0E-12 |
sp|B1AJG3|EFTU_UREP2 | Elongation factor Tu OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=tuf PE=3 SV=1 | 280 | 601 | 1.0E-12 |
sp|Q8FS84|EFTU_COREF | Elongation factor Tu OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=tuf PE=3 SV=1 | 243 | 604 | 1.0E-12 |
sp|A5CCA0|EFTU1_ORITB | Elongation factor Tu 1 OS=Orientia tsutsugamushi (strain Boryong) GN=tuf1 PE=3 SV=1 | 186 | 604 | 1.0E-12 |
sp|Q5F5Q8|EFTU_NEIG1 | Elongation factor Tu OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=tuf1 PE=3 SV=1 | 280 | 604 | 1.0E-12 |
sp|P42477|EFTU_HERAU | Elongation factor Tu OS=Herpetosiphon aurantiacus GN=tuf PE=3 SV=1 | 192 | 604 | 2.0E-12 |
sp|Q11Q98|EFTU_CYTH3 | Elongation factor Tu OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=tuf PE=3 SV=1 | 280 | 604 | 2.0E-12 |
sp|P27592|EF1A_ONCVO | Elongation factor 1-alpha OS=Onchocerca volvulus PE=2 SV=1 | 192 | 608 | 2.0E-12 |
sp|A5FZW7|EFTU_ACICJ | Elongation factor Tu OS=Acidiphilium cryptum (strain JF-5) GN=tuf PE=3 SV=1 | 192 | 604 | 2.0E-12 |
sp|B6YVG2|EF1A_THEON | Elongation factor 1-alpha OS=Thermococcus onnurineus (strain NA1) GN=tuf PE=3 SV=1 | 184 | 574 | 2.0E-12 |
sp|P41745|EF1A_BLAAD | Elongation factor 1-alpha OS=Blastobotrys adeninivorans GN=TEF PE=3 SV=1 | 192 | 608 | 2.0E-12 |
sp|P0CY35|EF1A1_CANAL | Elongation factor 1-alpha 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TEF1 PE=3 SV=1 | 192 | 608 | 2.0E-12 |
sp|A1KRF9|EFTU_NEIMF | Elongation factor Tu OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=tuf1 PE=3 SV=1 | 280 | 604 | 2.0E-12 |
sp|P64027|EFTU_NEIMB | Elongation factor Tu OS=Neisseria meningitidis serogroup B (strain MC58) GN=tufA PE=1 SV=1 | 280 | 604 | 2.0E-12 |
sp|P64026|EFTU_NEIMA | Elongation factor Tu OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=tufA PE=3 SV=1 | 280 | 604 | 2.0E-12 |
sp|Q12WT3|EF1A_METBU | Elongation factor 1-alpha OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=tuf PE=3 SV=1 | 186 | 586 | 2.0E-12 |
sp|Q07051|EF1A_EIMBO | Elongation factor 1-alpha (Fragment) OS=Eimeria bovis PE=2 SV=1 | 297 | 608 | 2.0E-12 |
sp|P50256|EF1AC_PORPU | Elongation factor 1-alpha C OS=Porphyra purpurea GN=TEF-C PE=2 SV=1 | 192 | 608 | 2.0E-12 |
sp|A1SNN5|EFTU_NOCSJ | Elongation factor Tu OS=Nocardioides sp. (strain BAA-499 / JS614) GN=tuf PE=3 SV=1 | 280 | 604 | 2.0E-12 |
sp|P90519|EF1A_CRYPV | Elongation factor 1-alpha OS=Cryptosporidium parvum PE=2 SV=1 | 192 | 608 | 2.0E-12 |
sp|P13537|EFTU_THEMA | Elongation factor Tu OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=tuf PE=3 SV=2 | 280 | 604 | 2.0E-12 |
sp|P42480|EFTU_HYMOC | Elongation factor Tu OS=Hymenobacter ocellatus GN=tuf PE=3 SV=1 | 280 | 604 | 3.0E-12 |
sp|B1LBP2|EFTU_THESQ | Elongation factor Tu OS=Thermotoga sp. (strain RQ2) GN=tuf PE=3 SV=1 | 280 | 604 | 3.0E-12 |
sp|A5IM81|EFTU_THEP1 | Elongation factor Tu OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=tuf PE=3 SV=1 | 280 | 604 | 3.0E-12 |
sp|P31018|EF1A_ENTHI | Elongation factor 1-alpha OS=Entamoeba histolytica PE=2 SV=1 | 192 | 608 | 3.0E-12 |
sp|A5CCL4|EFTU2_ORITB | Elongation factor Tu 2 OS=Orientia tsutsugamushi (strain Boryong) GN=tuf2 PE=3 SV=2 | 278 | 604 | 4.0E-12 |
sp|B5ZC31|EFTU_UREU1 | Elongation factor Tu OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=tuf PE=3 SV=1 | 280 | 601 | 4.0E-12 |
sp|Q2GFN6|EFTU_EHRCR | Elongation factor Tu OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=tuf1 PE=3 SV=1 | 280 | 604 | 5.0E-12 |
sp|P25166|EF1A_STYLE | Elongation factor 1-alpha OS=Stylonychia lemnae GN=EFAA PE=3 SV=1 | 192 | 591 | 5.0E-12 |
sp|Q055E6|EFTU_LEPBL | Elongation factor Tu OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=tuf1 PE=3 SV=1 | 280 | 601 | 5.0E-12 |
sp|Q04PT6|EFTU_LEPBJ | Elongation factor Tu OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=tuf PE=3 SV=1 | 280 | 601 | 5.0E-12 |
sp|A9BCK0|EFTU_PROM4 | Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9211) GN=tuf PE=3 SV=1 | 263 | 604 | 5.0E-12 |
sp|P42439|EFTU_CORGL | Elongation factor Tu OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=tuf PE=3 SV=1 | 243 | 604 | 5.0E-12 |
sp|A4QBH0|EFTU_CORGB | Elongation factor Tu OS=Corynebacterium glutamicum (strain R) GN=tuf PE=3 SV=1 | 243 | 604 | 6.0E-12 |
sp|P48864|EFTU_NEIGO | Elongation factor Tu OS=Neisseria gonorrhoeae GN=tuf PE=3 SV=1 | 280 | 604 | 6.0E-12 |
sp|Q47LJ1|EFTU_THEFY | Elongation factor Tu OS=Thermobifida fusca (strain YX) GN=tuf PE=3 SV=1 | 280 | 604 | 6.0E-12 |
sp|A7ZCN0|EFTU_CAMC1 | Elongation factor Tu OS=Campylobacter concisus (strain 13826) GN=tuf PE=3 SV=1 | 280 | 604 | 7.0E-12 |
sp|Q1GP97|EFTU_SPHAL | Elongation factor Tu OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=tuf PE=3 SV=1 | 192 | 604 | 7.0E-12 |
sp|A5WGK9|EFTU1_PSYWF | Elongation factor Tu 1 OS=Psychrobacter sp. (strain PRwf-1) GN=tuf1 PE=3 SV=1 | 280 | 604 | 7.0E-12 |
sp|O66429|EFTU_AQUAE | Elongation factor Tu OS=Aquifex aeolicus (strain VF5) GN=tufA PE=3 SV=1 | 192 | 604 | 8.0E-12 |
sp|A6LE88|EFTU_PARD8 | Elongation factor Tu OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=tuf PE=3 SV=1 | 243 | 599 | 9.0E-12 |
sp|Q83ES6|EFTU_COXBU | Elongation factor Tu OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=tufA PE=1 SV=1 | 192 | 604 | 1.0E-11 |
sp|A9NAK7|EFTU_COXBR | Elongation factor Tu OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=tuf1 PE=3 SV=1 | 192 | 604 | 1.0E-11 |
sp|A9KD33|EFTU_COXBN | Elongation factor Tu OS=Coxiella burnetii (strain Dugway 5J108-111) GN=tuf1 PE=3 SV=1 | 192 | 604 | 1.0E-11 |
sp|B2UQY9|EFTU_AKKM8 | Elongation factor Tu OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=tuf PE=3 SV=1 | 192 | 604 | 1.0E-11 |
sp|P42482|EFTU_WOLSU | Elongation factor Tu OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=tuf PE=3 SV=2 | 280 | 604 | 1.0E-11 |
sp|Q5HAS0|EFTU_EHRRW | Elongation factor Tu OS=Ehrlichia ruminantium (strain Welgevonden) GN=tuf1 PE=3 SV=1 | 279 | 604 | 1.0E-11 |
sp|Q5FFE6|EFTU_EHRRG | Elongation factor Tu OS=Ehrlichia ruminantium (strain Gardel) GN=tuf1 PE=3 SV=1 | 279 | 604 | 1.0E-11 |
sp|A5WH42|EFTU2_PSYWF | Elongation factor Tu 2 OS=Psychrobacter sp. (strain PRwf-1) GN=tuf2 PE=3 SV=1 | 280 | 604 | 1.0E-11 |
sp|P72231|EFTU_PLARO | Elongation factor Tu OS=Planobispora rosea GN=tuf PE=3 SV=2 | 192 | 604 | 1.0E-11 |
sp|O50340|EFTU_FERIS | Elongation factor Tu OS=Fervidobacterium islandicum GN=tuf PE=3 SV=1 | 280 | 604 | 1.0E-11 |
sp|Q5FTY1|EFTU_GLUOX | Elongation factor Tu OS=Gluconobacter oxydans (strain 621H) GN=tuf PE=3 SV=1 | 280 | 604 | 1.0E-11 |
sp|A1T4L6|EFTU_MYCVP | Elongation factor Tu OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=tuf PE=3 SV=1 | 280 | 604 | 1.0E-11 |
sp|B1VET1|EFTU_CORU7 | Elongation factor Tu OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=tuf PE=3 SV=1 | 280 | 604 | 1.0E-11 |
sp|Q7VA05|EFTU_PROMA | Elongation factor Tu OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=tuf PE=3 SV=1 | 263 | 604 | 1.0E-11 |
sp|Q3YRK7|EFTU_EHRCJ | Elongation factor Tu OS=Ehrlichia canis (strain Jake) GN=tuf1 PE=3 SV=1 | 279 | 604 | 2.0E-11 |
sp|Q73H85|EFTU2_WOLPM | Elongation factor Tu 2 OS=Wolbachia pipientis wMel GN=tuf2 PE=3 SV=1 | 280 | 604 | 2.0E-11 |
sp|Q73IX6|EFTU1_WOLPM | Elongation factor Tu 1 OS=Wolbachia pipientis wMel GN=tuf1 PE=3 SV=1 | 280 | 604 | 2.0E-11 |
sp|Q5YPG4|EFTU_NOCFA | Elongation factor Tu OS=Nocardia farcinica (strain IFM 10152) GN=tuf PE=3 SV=2 | 280 | 604 | 2.0E-11 |
sp|P0CT55|EF1A3_SCHPO | Elongation factor 1-alpha-B/C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef103 PE=1 SV=1 | 192 | 608 | 2.0E-11 |
sp|P0CT54|EF1A2_SCHPO | Elongation factor 1-alpha-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef102 PE=1 SV=1 | 192 | 608 | 2.0E-11 |
sp|C6C171|EFTU_DESAD | Elongation factor Tu OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=tuf PE=3 SV=1 | 218 | 604 | 2.0E-11 |
sp|Q1RHL9|EFTU_RICBR | Elongation factor Tu OS=Rickettsia bellii (strain RML369-C) GN=tuf PE=3 SV=1 | 192 | 604 | 2.0E-11 |
sp|A8GVB2|EFTU_RICB8 | Elongation factor Tu OS=Rickettsia bellii (strain OSU 85-389) GN=tuf PE=3 SV=1 | 192 | 604 | 2.0E-11 |
sp|A5DPE3|EF1A_PICGU | Elongation factor 1-alpha OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TEF1 PE=3 SV=2 | 192 | 608 | 2.0E-11 |
sp|Q1MPT8|EFTU_LAWIP | Elongation factor Tu OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=tuf PE=3 SV=1 | 218 | 604 | 2.0E-11 |
sp|Q5NQ65|EFTU_ZYMMO | Elongation factor Tu OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=tuf PE=3 SV=1 | 192 | 604 | 2.0E-11 |
sp|P0CT53|EF1A1_SCHPO | Elongation factor 1-alpha-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef101 PE=1 SV=1 | 192 | 608 | 2.0E-11 |
sp|A8M531|EFTU_SALAI | Elongation factor Tu OS=Salinispora arenicola (strain CNS-205) GN=tuf PE=3 SV=1 | 192 | 604 | 2.0E-11 |
sp|Q9Z9A7|EFTU_CHLPN | Elongation factor Tu OS=Chlamydia pneumoniae GN=tuf PE=3 SV=3 | 192 | 531 | 2.0E-11 |
sp|A7HM54|EFTU_FERNB | Elongation factor Tu OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=tuf PE=3 SV=1 | 280 | 604 | 3.0E-11 |
sp|A7GZK6|EFTU_CAMC5 | Elongation factor Tu OS=Campylobacter curvus (strain 525.92) GN=tuf PE=3 SV=1 | 280 | 604 | 3.0E-11 |
sp|O50293|EFTU_AQUPY | Elongation factor Tu OS=Aquifex pyrophilus GN=tuf PE=3 SV=1 | 192 | 604 | 3.0E-11 |
sp|A2C4U5|EFTU_PROM1 | Elongation factor Tu OS=Prochlorococcus marinus (strain NATL1A) GN=tuf PE=3 SV=1 | 263 | 604 | 3.0E-11 |
sp|A7HWP7|EFTU_PARL1 | Elongation factor Tu OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=tuf1 PE=3 SV=1 | 192 | 604 | 3.0E-11 |
sp|Q2N9A8|EFTU_ERYLH | Elongation factor Tu OS=Erythrobacter litoralis (strain HTCC2594) GN=tuf PE=3 SV=1 | 192 | 604 | 4.0E-11 |
sp|Q9ZT91|EFTM_ARATH | Elongation factor Tu, mitochondrial OS=Arabidopsis thaliana GN=TUFA PE=1 SV=1 | 192 | 604 | 4.0E-11 |
sp|Q5WZL4|EFTU_LEGPL | Elongation factor Tu OS=Legionella pneumophila (strain Lens) GN=tuf1 PE=3 SV=1 | 263 | 604 | 4.0E-11 |
sp|A4FPM7|EFTU_SACEN | Elongation factor Tu OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=tuf PE=3 SV=1 | 280 | 604 | 4.0E-11 |
sp|Q8DI42|EFTU_THEEB | Elongation factor Tu OS=Thermosynechococcus elongatus (strain BP-1) GN=tuf PE=3 SV=1 | 192 | 604 | 4.0E-11 |
sp|Q15NP2|EFTU_PSEA6 | Elongation factor Tu OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=tuf1 PE=3 SV=1 | 192 | 604 | 4.0E-11 |
sp|A0QS98|EFTU_MYCS2 | Elongation factor Tu OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=tuf PE=1 SV=1 | 280 | 604 | 4.0E-11 |
sp|Q08046|EF1A_GIAIN | Elongation factor 1-alpha (Fragment) OS=Giardia intestinalis GN=TEF1 PE=2 SV=1 | 275 | 612 | 4.0E-11 |
sp|A0LRL8|EFTU_ACIC1 | Elongation factor Tu OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=tuf PE=3 SV=1 | 280 | 604 | 4.0E-11 |
sp|Q30X13|EFTU_DESAG | Elongation factor Tu OS=Desulfovibrio alaskensis (strain G20) GN=tuf PE=3 SV=1 | 280 | 604 | 5.0E-11 |
sp|Q46IW4|EFTU_PROMT | Elongation factor Tu OS=Prochlorococcus marinus (strain NATL2A) GN=tuf PE=3 SV=1 | 263 | 604 | 5.0E-11 |
sp|A1VAK4|EFTU_DESVV | Elongation factor Tu OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=tuf PE=3 SV=1 | 192 | 604 | 5.0E-11 |
sp|Q727D5|EFTU_DESVH | Elongation factor Tu OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=tuf PE=3 SV=1 | 192 | 604 | 5.0E-11 |
sp|A4SCQ7|EFTU_CHLPM | Elongation factor Tu OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=tuf PE=3 SV=1 | 182 | 604 | 5.0E-11 |
sp|Q5GWR8|EFTU_XANOR | Elongation factor Tu OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=tuf1 PE=3 SV=1 | 192 | 604 | 5.0E-11 |
sp|Q2NZX1|EFTU_XANOM | Elongation factor Tu OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=tuf1 PE=3 SV=1 | 192 | 604 | 5.0E-11 |
sp|Q96WZ1|EF1A_COCIM | Elongation factor 1-alpha OS=Coccidioides immitis (strain RS) GN=TEF PE=2 SV=2 | 185 | 608 | 5.0E-11 |
sp|Q6YQV8|EFTU_ONYPE | Elongation factor Tu OS=Onion yellows phytoplasma (strain OY-M) GN=tuf PE=3 SV=1 | 280 | 601 | 5.0E-11 |
sp|A7I3U7|EFTU_CAMHC | Elongation factor Tu OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=tuf PE=3 SV=1 | 280 | 604 | 5.0E-11 |
sp|Q5ZYP5|EFTU_LEGPH | Elongation factor Tu OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=tuf1 PE=3 SV=1 | 263 | 604 | 6.0E-11 |
sp|A5IHR6|EFTU_LEGPC | Elongation factor Tu OS=Legionella pneumophila (strain Corby) GN=tuf1 PE=3 SV=1 | 263 | 604 | 6.0E-11 |
sp|Q5X873|EFTU_LEGPA | Elongation factor Tu OS=Legionella pneumophila (strain Paris) GN=tuf1 PE=3 SV=1 | 263 | 604 | 6.0E-11 |
sp|A5GIP0|EFTU_SYNPW | Elongation factor Tu OS=Synechococcus sp. (strain WH7803) GN=tuf PE=3 SV=1 | 280 | 604 | 6.0E-11 |
sp|Q4JT41|EFTU_CORJK | Elongation factor Tu OS=Corynebacterium jeikeium (strain K411) GN=tuf PE=3 SV=1 | 280 | 604 | 6.0E-11 |
sp|Q250N4|EFTU_DESHY | Elongation factor Tu OS=Desulfitobacterium hafniense (strain Y51) GN=tuf PE=3 SV=1 | 280 | 604 | 6.0E-11 |
sp|B8G1W4|EFTU_DESHD | Elongation factor Tu OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=tuf PE=3 SV=1 | 280 | 604 | 6.0E-11 |
sp|P17786|EF1A_SOLLC | Elongation factor 1-alpha OS=Solanum lycopersicum PE=2 SV=1 | 184 | 608 | 7.0E-11 |
sp|A6Q1L5|EFTU_NITSB | Elongation factor Tu OS=Nitratiruptor sp. (strain SB155-2) GN=tuf PE=3 SV=1 | 280 | 604 | 7.0E-11 |
sp|C4Z2R9|EFTU_EUBE2 | Elongation factor Tu OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=tuf PE=3 SV=1 | 192 | 531 | 7.0E-11 |
sp|A5DN78|EFTU_PICGU | Elongation factor Tu, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TUF1 PE=3 SV=1 | 149 | 531 | 8.0E-11 |
sp|P34824|EF1A1_HORVU | Elongation factor 1-alpha OS=Hordeum vulgare PE=1 SV=1 | 185 | 608 | 8.0E-11 |
sp|P42474|EFTU_CELLY | Elongation factor Tu OS=Cellulophaga lytica GN=tuf PE=3 SV=1 | 280 | 604 | 8.0E-11 |
sp|P28295|EF1A_ABSGL | Elongation factor 1-alpha OS=Absidia glauca GN=TEF-1 PE=3 SV=1 | 192 | 608 | 9.0E-11 |
sp|Q3J8Q0|EFTU_NITOC | Elongation factor Tu OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=tuf1 PE=3 SV=1 | 280 | 604 | 9.0E-11 |
sp|A3PEZ7|EFTU_PROM0 | Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9301) GN=tuf PE=3 SV=1 | 263 | 604 | 9.0E-11 |
sp|A8G708|EFTU_PROM2 | Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9215) GN=tuf PE=3 SV=1 | 263 | 604 | 9.0E-11 |
sp|A2BT83|EFTU_PROMS | Elongation factor Tu OS=Prochlorococcus marinus (strain AS9601) GN=tuf PE=3 SV=1 | 263 | 604 | 9.0E-11 |
sp|Q8PC51|EFTU2_XANCP | Elongation factor Tu-B OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=tufB PE=3 SV=1 | 186 | 604 | 1.0E-10 |
sp|Q4URD7|EFTU1_XANC8 | Elongation factor Tu 1 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=tuf1 PE=3 SV=1 | 186 | 604 | 1.0E-10 |
sp|B0RU84|EFTU1_XANCB | Elongation factor Tu 1 OS=Xanthomonas campestris pv. campestris (strain B100) GN=tuf1 PE=3 SV=1 | 186 | 604 | 1.0E-10 |
sp|B0RU96|EFTU2_XANCB | Elongation factor Tu 2 OS=Xanthomonas campestris pv. campestris (strain B100) GN=tuf2 PE=3 SV=1 | 186 | 604 | 1.0E-10 |
sp|Q4URC5|EFTU2_XANC8 | Elongation factor Tu 2 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=tuf2 PE=3 SV=1 | 186 | 604 | 1.0E-10 |
sp|Q8PC59|EFTU1_XANCP | Elongation factor Tu-A OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=tufA PE=3 SV=1 | 186 | 604 | 1.0E-10 |
sp|B0SSH9|EFTU_LEPBP | Elongation factor Tu OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=tuf PE=3 SV=1 | 280 | 604 | 1.0E-10 |
sp|B0SAF6|EFTU_LEPBA | Elongation factor Tu OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=tuf PE=3 SV=1 | 280 | 604 | 1.0E-10 |
sp|Q2RFP5|EFTU_MOOTA | Elongation factor Tu OS=Moorella thermoacetica (strain ATCC 39073) GN=tuf PE=3 SV=1 | 280 | 604 | 1.0E-10 |
sp|Q6N4Q4|EFTU_RHOPA | Elongation factor Tu OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=tuf1 PE=3 SV=1 | 192 | 604 | 1.0E-10 |
sp|Q2G8Y2|EFTU_NOVAD | Elongation factor Tu OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=tuf PE=3 SV=1 | 192 | 604 | 1.0E-10 |
sp|Q8EX18|EFTU_MYCPE | Elongation factor Tu OS=Mycoplasma penetrans (strain HF-2) GN=tuf PE=3 SV=1 | 218 | 604 | 1.0E-10 |
sp|Q48D34|EFTU_PSE14 | Elongation factor Tu OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=tuf PE=3 SV=1 | 192 | 604 | 1.0E-10 |
sp|A4XBP8|EFTU_SALTO | Elongation factor Tu OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=tuf PE=3 SV=1 | 245 | 604 | 1.0E-10 |
sp|A0RQJ3|EFTU_CAMFF | Elongation factor Tu OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=tuf PE=3 SV=1 | 280 | 604 | 1.0E-10 |
sp|A2BYN4|EFTU_PROM5 | Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9515) GN=tuf PE=3 SV=1 | 263 | 604 | 1.0E-10 |
sp|Q255F3|EFTU_CHLFF | Elongation factor Tu OS=Chlamydophila felis (strain Fe/C-56) GN=tuf PE=3 SV=1 | 280 | 604 | 1.0E-10 |
sp|Q57918|SELB_METJA | Selenocysteine-specific elongation factor OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=selB PE=3 SV=1 | 276 | 590 | 2.0E-10 |
sp|O49169|EF1A_MANES | Elongation factor 1-alpha OS=Manihot esculenta GN=EF1 PE=3 SV=1 | 184 | 608 | 2.0E-10 |
sp|P42481|EFTU_THIDL | Elongation factor Tu OS=Thiomonas delicata GN=tuf PE=3 SV=1 | 232 | 604 | 2.0E-10 |
sp|P34823|EF1A2_DAUCA | Elongation factor 1-alpha OS=Daucus carota PE=2 SV=1 | 184 | 608 | 2.0E-10 |
sp|Q822I4|EFTU_CHLCV | Elongation factor Tu OS=Chlamydophila caviae (strain GPIC) GN=tuf PE=3 SV=3 | 280 | 604 | 2.0E-10 |
sp|Q3BWY6|EFTU_XANC5 | Elongation factor Tu OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=tuf1 PE=3 SV=1 | 192 | 604 | 2.0E-10 |
sp|Q8NL22|EFTU_XANAC | Elongation factor Tu OS=Xanthomonas axonopodis pv. citri (strain 306) GN=tufA PE=3 SV=1 | 192 | 604 | 2.0E-10 |
sp|Q73SD1|EFTU_MYCPA | Elongation factor Tu OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=tuf PE=3 SV=1 | 280 | 604 | 2.0E-10 |
sp|A0QL35|EFTU_MYCA1 | Elongation factor Tu OS=Mycobacterium avium (strain 104) GN=tuf PE=3 SV=1 | 280 | 604 | 2.0E-10 |
sp|Q2IXR2|EFTU_RHOP2 | Elongation factor Tu OS=Rhodopseudomonas palustris (strain HaA2) GN=tuf1 PE=3 SV=1 | 192 | 604 | 2.0E-10 |
sp|P64029|EFTU_STAAW | Elongation factor Tu OS=Staphylococcus aureus (strain MW2) GN=tuf PE=3 SV=1 | 280 | 604 | 2.0E-10 |
sp|A8YZP5|EFTU_STAAT | Elongation factor Tu OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=tuf PE=3 SV=1 | 280 | 604 | 2.0E-10 |
sp|Q6GBT9|EFTU_STAAS | Elongation factor Tu OS=Staphylococcus aureus (strain MSSA476) GN=tuf PE=3 SV=1 | 280 | 604 | 2.0E-10 |
sp|Q6GJC0|EFTU_STAAR | Elongation factor Tu OS=Staphylococcus aureus (strain MRSA252) GN=tuf PE=3 SV=1 | 280 | 604 | 2.0E-10 |
sp|P99152|EFTU_STAAN | Elongation factor Tu OS=Staphylococcus aureus (strain N315) GN=tuf PE=1 SV=1 | 280 | 604 | 2.0E-10 |
sp|P64028|EFTU_STAAM | Elongation factor Tu OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=tuf PE=3 SV=1 | 280 | 604 | 2.0E-10 |
sp|A6QEK0|EFTU_STAAE | Elongation factor Tu OS=Staphylococcus aureus (strain Newman) GN=tuf PE=3 SV=1 | 280 | 604 | 2.0E-10 |
sp|Q5HIC7|EFTU_STAAC | Elongation factor Tu OS=Staphylococcus aureus (strain COL) GN=tuf PE=3 SV=1 | 280 | 604 | 2.0E-10 |
sp|Q2YSB3|EFTU_STAAB | Elongation factor Tu OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=tuf PE=3 SV=1 | 280 | 604 | 2.0E-10 |
sp|A5IQA2|EFTU_STAA9 | Elongation factor Tu OS=Staphylococcus aureus (strain JH9) GN=tuf PE=3 SV=1 | 280 | 604 | 2.0E-10 |
sp|Q2G0N0|EFTU_STAA8 | Elongation factor Tu OS=Staphylococcus aureus (strain NCTC 8325) GN=tuf PE=3 SV=1 | 280 | 604 | 2.0E-10 |
sp|Q2FJ92|EFTU_STAA3 | Elongation factor Tu OS=Staphylococcus aureus (strain USA300) GN=tuf PE=3 SV=1 | 280 | 604 | 2.0E-10 |
sp|A6TZ25|EFTU_STAA2 | Elongation factor Tu OS=Staphylococcus aureus (strain JH1) GN=tuf PE=3 SV=1 | 280 | 604 | 2.0E-10 |
sp|A7WYX6|EFTU_STAA1 | Elongation factor Tu OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=tuf PE=3 SV=1 | 280 | 604 | 2.0E-10 |
sp|Q9XD38|EFTU_LEPIN | Elongation factor Tu OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=tuf PE=3 SV=1 | 280 | 604 | 2.0E-10 |
sp|Q72NF9|EFTU_LEPIC | Elongation factor Tu OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=tuf PE=3 SV=1 | 280 | 604 | 2.0E-10 |
sp|B8DLL9|EFTU_DESVM | Elongation factor Tu OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=tuf PE=3 SV=1 | 192 | 604 | 2.0E-10 |
sp|P41752|EF1A_ASHGO | Elongation factor 1-alpha OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TEF PE=3 SV=1 | 192 | 608 | 2.0E-10 |
sp|Q318N5|EFTU_PROM9 | Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9312) GN=tuf PE=3 SV=1 | 263 | 604 | 3.0E-10 |
sp|Q4ZMP2|EFTU_PSEU2 | Elongation factor Tu OS=Pseudomonas syringae pv. syringae (strain B728a) GN=tuf PE=3 SV=1 | 280 | 604 | 3.0E-10 |
sp|O21245|EFTU_RECAM | Elongation factor Tu, mitochondrial OS=Reclinomonas americana GN=TUFA PE=3 SV=1 | 280 | 604 | 3.0E-10 |
sp|Q6MDN0|EFTU_PARUW | Elongation factor Tu OS=Protochlamydia amoebophila (strain UWE25) GN=tuf PE=3 SV=1 | 192 | 604 | 3.0E-10 |
sp|B0TX03|EFTU_FRAP2 | Elongation factor Tu OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=tuf PE=3 SV=1 | 192 | 604 | 3.0E-10 |
sp|A2SLF9|EFTU_METPP | Elongation factor Tu OS=Methylibium petroleiphilum (strain PM1) GN=tuf1 PE=3 SV=1 | 237 | 604 | 3.0E-10 |
sp|A0M3Z6|EFTU_GRAFK | Elongation factor Tu OS=Gramella forsetii (strain KT0803) GN=tuf PE=3 SV=1 | 280 | 604 | 3.0E-10 |
sp|Q2NJ20|EFTU_AYWBP | Elongation factor Tu OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=tuf PE=3 SV=1 | 280 | 601 | 3.0E-10 |
sp|Q889X3|EFTU_PSESM | Elongation factor Tu OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=tuf PE=3 SV=1 | 192 | 604 | 3.0E-10 |
sp|Q5L5H6|EFTU_CHLAB | Elongation factor Tu OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=tuf PE=3 SV=1 | 280 | 604 | 3.0E-10 |
sp|O64937|EF1A_ORYSJ | Elongation factor 1-alpha OS=Oryza sativa subsp. japonica GN=REFA1 PE=2 SV=2 | 192 | 608 | 4.0E-10 |
sp|Q0BUQ2|EFTU_GRABC | Elongation factor Tu OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=tuf PE=3 SV=1 | 192 | 604 | 4.0E-10 |
sp|A9H3R7|EFTU_GLUDA | Elongation factor Tu OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=tuf PE=3 SV=1 | 192 | 604 | 4.0E-10 |
sp|B9MQH1|EFTU_CALBD | Elongation factor Tu OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=tuf PE=3 SV=1 | 192 | 604 | 4.0E-10 |
sp|P13927|EFTU_MYCGE | Elongation factor Tu OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=tuf PE=3 SV=1 | 280 | 604 | 4.0E-10 |
sp|B6JN44|EFTU_HELP2 | Elongation factor Tu OS=Helicobacter pylori (strain P12) GN=tuf PE=3 SV=1 | 280 | 604 | 4.0E-10 |
sp|A6VKH7|EFTU_ACTSZ | Elongation factor Tu OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=tuf1 PE=3 SV=1 | 280 | 604 | 4.0E-10 |
sp|Q5QWA3|EFTU_IDILO | Elongation factor Tu OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=tuf1 PE=3 SV=1 | 192 | 604 | 4.0E-10 |
sp|Q5HVZ7|EFTU_CAMJR | Elongation factor Tu OS=Campylobacter jejuni (strain RM1221) GN=tuf PE=3 SV=1 | 280 | 604 | 5.0E-10 |
sp|A1VYI6|EFTU_CAMJJ | Elongation factor Tu OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=tuf PE=3 SV=1 | 280 | 604 | 5.0E-10 |
sp|O69303|EFTU_CAMJE | Elongation factor Tu OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=tuf PE=3 SV=1 | 280 | 604 | 5.0E-10 |
sp|A7H4R3|EFTU_CAMJD | Elongation factor Tu OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=tuf PE=3 SV=1 | 280 | 604 | 5.0E-10 |
sp|A8FKQ5|EFTU_CAMJ8 | Elongation factor Tu OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=tuf PE=3 SV=1 | 280 | 604 | 5.0E-10 |
sp|P43643|EF1A_TOBAC | Elongation factor 1-alpha OS=Nicotiana tabacum PE=2 SV=1 | 184 | 608 | 5.0E-10 |
sp|C4K4F8|EFTU_HAMD5 | Elongation factor Tu OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=tuf PE=3 SV=1 | 280 | 604 | 5.0E-10 |
sp|A4XI37|EFTU_CALS8 | Elongation factor Tu OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=tuf PE=3 SV=1 | 192 | 604 | 5.0E-10 |
sp|C0ZIH6|EFTU_BREBN | Elongation factor Tu OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=tuf PE=3 SV=1 | 280 | 604 | 5.0E-10 |
sp|Q1QN32|EFTU_NITHX | Elongation factor Tu OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=tuf PE=3 SV=1 | 192 | 604 | 5.0E-10 |
sp|Q89J82|EFTU_BRADU | Elongation factor Tu OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=tuf PE=3 SV=1 | 192 | 604 | 5.0E-10 |
sp|Q4L3K9|EFTU_STAHJ | Elongation factor Tu OS=Staphylococcus haemolyticus (strain JCSC1435) GN=tuf PE=3 SV=1 | 280 | 604 | 6.0E-10 |
sp|Q7UZY7|EFTU_PROMP | Elongation factor Tu OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=tuf PE=3 SV=1 | 280 | 604 | 6.0E-10 |
sp|P42475|EFTU_FIBSS | Elongation factor Tu OS=Fibrobacter succinogenes (strain ATCC 19169 / S85) GN=tuf1 PE=3 SV=2 | 280 | 604 | 6.0E-10 |
sp|C5C0J3|EFTU_BEUC1 | Elongation factor Tu OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=tuf PE=3 SV=1 | 280 | 604 | 6.0E-10 |
sp|A4IW92|EFTU_FRATW | Elongation factor Tu OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=tuf PE=3 SV=1 | 192 | 604 | 6.0E-10 |
sp|Q0BKB8|EFTU_FRATO | Elongation factor Tu OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=tuf PE=3 SV=1 | 192 | 604 | 6.0E-10 |
sp|A0Q874|EFTU_FRATN | Elongation factor Tu OS=Francisella tularensis subsp. novicida (strain U112) GN=tuf PE=3 SV=1 | 192 | 604 | 6.0E-10 |
sp|B2SFC9|EFTU_FRATM | Elongation factor Tu OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=tuf PE=3 SV=1 | 192 | 604 | 6.0E-10 |
sp|Q2A1M0|EFTU_FRATH | Elongation factor Tu OS=Francisella tularensis subsp. holarctica (strain LVS) GN=tuf PE=3 SV=1 | 192 | 604 | 6.0E-10 |
sp|A7NEC7|EFTU_FRATF | Elongation factor Tu OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=tuf PE=3 SV=1 | 192 | 604 | 6.0E-10 |
sp|B0SUQ7|EFTU1_CAUSK | Elongation factor Tu 1 OS=Caulobacter sp. (strain K31) GN=tuf1 PE=3 SV=1 | 263 | 604 | 7.0E-10 |
sp|B0JSE0|EFTU_MICAN | Elongation factor Tu OS=Microcystis aeruginosa (strain NIES-843) GN=tuf PE=3 SV=1 | 280 | 604 | 7.0E-10 |
sp|Q40034|EF1A2_HORVU | Elongation factor 1-alpha OS=Hordeum vulgare GN=BLT63 PE=1 SV=1 | 185 | 608 | 7.0E-10 |
sp|Q9PK73|EFTU_CHLMU | Elongation factor Tu OS=Chlamydia muridarum (strain MoPn / Nigg) GN=tuf PE=3 SV=3 | 192 | 604 | 7.0E-10 |
sp|A1AVJ8|EFTU1_RUTMC | Elongation factor Tu 1 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=tuf1 PE=3 SV=1 | 192 | 604 | 7.0E-10 |
sp|Q2S1P8|EFTU_SALRD | Elongation factor Tu OS=Salinibacter ruber (strain DSM 13855 / M31) GN=tuf1 PE=3 SV=1 | 280 | 604 | 7.0E-10 |
sp|P42471|EFTU_BRELN | Elongation factor Tu OS=Brevibacterium linens GN=tuf PE=3 SV=1 | 192 | 604 | 7.0E-10 |
sp|Q5NID9|EFTU_FRATT | Elongation factor Tu OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=tuf PE=3 SV=1 | 192 | 604 | 7.0E-10 |
sp|Q14JU2|EFTU_FRAT1 | Elongation factor Tu OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=tuf PE=3 SV=1 | 192 | 604 | 7.0E-10 |
sp|P29542|EFTU1_STRRA | Elongation factor Tu-1 OS=Streptomyces ramocissimus GN=tuf1 PE=3 SV=1 | 247 | 604 | 7.0E-10 |
sp|A5V604|EFTU_SPHWW | Elongation factor Tu OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=tuf PE=3 SV=1 | 192 | 604 | 7.0E-10 |
sp|Q3A9R3|EFTU1_CARHZ | Elongation factor Tu 1 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=tuf1 PE=3 SV=1 | 280 | 604 | 8.0E-10 |
sp|Q8CQ81|EFTU_STAES | Elongation factor Tu OS=Staphylococcus epidermidis (strain ATCC 12228) GN=tuf PE=3 SV=1 | 280 | 604 | 8.0E-10 |
sp|Q5HRK4|EFTU_STAEQ | Elongation factor Tu OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=tuf PE=3 SV=1 | 280 | 604 | 8.0E-10 |
sp|A5IYA9|EFTU_MYCAP | Elongation factor Tu OS=Mycoplasma agalactiae (strain PG2) GN=tuf PE=3 SV=1 | 280 | 604 | 8.0E-10 |
sp|Q134S7|EFTU1_RHOPS | Elongation factor Tu 1 OS=Rhodopseudomonas palustris (strain BisB5) GN=tuf1 PE=3 SV=1 | 192 | 604 | 8.0E-10 |
sp|A4YSJ0|EFTU_BRASO | Elongation factor Tu OS=Bradyrhizobium sp. (strain ORS278) GN=tuf PE=3 SV=1 | 192 | 604 | 8.0E-10 |
sp|A5ELM9|EFTU_BRASB | Elongation factor Tu OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=tuf PE=3 SV=1 | 192 | 604 | 8.0E-10 |
sp|Q6A6L7|EFTU_PROAC | Elongation factor Tu OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=tuf PE=3 SV=1 | 280 | 530 | 8.0E-10 |
sp|Q839G8|EFTU_ENTFA | Elongation factor Tu OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=tuf PE=3 SV=1 | 218 | 604 | 8.0E-10 |
sp|B2UUW8|EFTU_HELPS | Elongation factor Tu OS=Helicobacter pylori (strain Shi470) GN=tuf PE=3 SV=1 | 280 | 604 | 8.0E-10 |
sp|Q3A9P8|EFTU2_CARHZ | Elongation factor Tu 2 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=tuf2 PE=3 SV=1 | 280 | 604 | 8.0E-10 |
sp|Q9ZK19|EFTU_HELPJ | Elongation factor Tu OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=tuf PE=3 SV=1 | 280 | 604 | 9.0E-10 |
sp|Q3A6R2|EFTU1_PELCD | Elongation factor Tu 1 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=tuf1 PE=3 SV=1 | 280 | 604 | 9.0E-10 |
sp|B3PMU1|EFTU_MYCA5 | Elongation factor Tu OS=Mycoplasma arthritidis (strain 158L3-1) GN=tuf PE=3 SV=1 | 280 | 604 | 9.0E-10 |
sp|B5Z8K3|EFTU_HELPG | Elongation factor Tu OS=Helicobacter pylori (strain G27) GN=tuf PE=3 SV=1 | 280 | 604 | 1.0E-09 |
sp|P29521|EF1A1_DAUCA | Elongation factor 1-alpha OS=Daucus carota PE=1 SV=1 | 184 | 608 | 1.0E-09 |
sp|O59949|EF1A_YARLI | Elongation factor 1-alpha OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TEF PE=2 SV=2 | 192 | 608 | 1.0E-09 |
sp|O24534|EF1A_VICFA | Elongation factor 1-alpha OS=Vicia faba PE=2 SV=1 | 184 | 608 | 1.0E-09 |
sp|P56003|EFTU_HELPY | Elongation factor Tu OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=tuf PE=3 SV=1 | 280 | 604 | 1.0E-09 |
sp|Q134R0|EFTU2_RHOPS | Elongation factor Tu 2 OS=Rhodopseudomonas palustris (strain BisB5) GN=tuf2 PE=3 SV=1 | 192 | 604 | 1.0E-09 |
sp|Q748X8|EFTU_GEOSL | Elongation factor Tu OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=tuf1 PE=3 SV=1 | 192 | 604 | 1.0E-09 |
sp|C4LL63|EFTU_CORK4 | Elongation factor Tu OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=tuf PE=3 SV=1 | 280 | 604 | 1.0E-09 |
sp|O42820|EF1A_SCHCO | Elongation factor 1-alpha OS=Schizophyllum commune GN=TEF1 PE=3 SV=1 | 184 | 591 | 1.0E-09 |
sp|Q211E6|EFTU_RHOPB | Elongation factor Tu OS=Rhodopseudomonas palustris (strain BisB18) GN=tuf PE=3 SV=1 | 192 | 604 | 1.0E-09 |
sp|P42476|EFTU_TERFE | Elongation factor Tu OS=Terrimonas ferruginea GN=tuf PE=3 SV=1 | 192 | 604 | 1.0E-09 |
sp|Q6NJD5|EFTU_CORDI | Elongation factor Tu OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=tuf PE=3 SV=1 | 243 | 604 | 1.0E-09 |
sp|B3ETZ7|EFTU_AMOA5 | Elongation factor Tu OS=Amoebophilus asiaticus (strain 5a2) GN=tuf PE=3 SV=1 | 192 | 599 | 1.0E-09 |
sp|Q3SSW8|EFTU_NITWN | Elongation factor Tu OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=tuf PE=3 SV=1 | 192 | 604 | 1.0E-09 |
sp|P22679|EFTU_MYCHP | Elongation factor Tu OS=Mycoplasma hominis (strain ATCC 23114 / NBRC 14850 / NCTC 10111 / PG21) GN=tuf PE=1 SV=1 | 280 | 604 | 1.0E-09 |
sp|Q6AP86|EFTU1_DESPS | Elongation factor Tu 1 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=tuf1 PE=3 SV=1 | 263 | 604 | 1.0E-09 |
sp|Q6LVC0|EFTU1_PHOPR | Elongation factor Tu 1 OS=Photobacterium profundum GN=tuf1 PE=3 SV=1 | 192 | 604 | 1.0E-09 |
sp|C4ZB99|EFTU_EUBR3 | Elongation factor Tu OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=tuf PE=3 SV=1 | 280 | 531 | 2.0E-09 |
sp|P0CD71|EFTU_CHLTR | Elongation factor Tu OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=tuf PE=3 SV=1 | 192 | 604 | 2.0E-09 |
sp|Q3KM40|EFTU_CHLTA | Elongation factor Tu OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=tuf PE=3 SV=1 | 192 | 604 | 2.0E-09 |
sp|Q8R7T8|EFTU2_CALS4 | Elongation factor Tu-B OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=tufB PE=3 SV=1 | 246 | 604 | 2.0E-09 |
sp|P9WNN1|EFTU_MYCTU | Elongation factor Tu OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=tuf PE=1 SV=1 | 280 | 604 | 2.0E-09 |
sp|P9WNN0|EFTU_MYCTO | Elongation factor Tu OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=tuf PE=3 SV=1 | 280 | 604 | 2.0E-09 |
sp|A5U071|EFTU_MYCTA | Elongation factor Tu OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=tuf PE=3 SV=1 | 280 | 604 | 2.0E-09 |
sp|C1AL18|EFTU_MYCBT | Elongation factor Tu OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=tuf PE=3 SV=1 | 280 | 604 | 2.0E-09 |
sp|A1KGG5|EFTU_MYCBP | Elongation factor Tu OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=tuf PE=3 SV=1 | 280 | 604 | 2.0E-09 |
sp|P0A559|EFTU_MYCBO | Elongation factor Tu OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=tuf PE=3 SV=1 | 280 | 604 | 2.0E-09 |
sp|Q05FI3|EFTU_CARRP | Elongation factor Tu OS=Carsonella ruddii (strain PV) GN=tuf PE=3 SV=1 | 186 | 607 | 2.0E-09 |
sp|Q03033|EF1A_WHEAT | Elongation factor 1-alpha OS=Triticum aestivum GN=TEF1 PE=2 SV=1 | 192 | 608 | 2.0E-09 |
sp|A8F4Q9|EFTU_PSELT | Elongation factor Tu OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=tuf PE=3 SV=1 | 280 | 604 | 2.0E-09 |
sp|A5CW32|EFTU_VESOH | Elongation factor Tu OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=tuf1 PE=3 SV=1 | 192 | 604 | 2.0E-09 |
sp|A0PM42|EFTU_MYCUA | Elongation factor Tu OS=Mycobacterium ulcerans (strain Agy99) GN=tuf PE=3 SV=1 | 280 | 604 | 2.0E-09 |
sp|B2HSL3|EFTU_MYCMM | Elongation factor Tu OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=tuf PE=3 SV=1 | 280 | 604 | 2.0E-09 |
sp|Q99QM0|EFTU_CAUCR | Elongation factor Tu OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=tufA PE=3 SV=1 | 263 | 604 | 2.0E-09 |
sp|P42473|EFTU_CHLP8 | Elongation factor Tu OS=Chlorobaculum parvum (strain NCIB 8327) GN=tuf PE=3 SV=1 | 182 | 604 | 2.0E-09 |
sp|Q6FF97|EFTU_ACIAD | Elongation factor Tu OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=tuf1 PE=3 SV=1 | 280 | 604 | 2.0E-09 |
sp|Q81ZS3|EFTU_NITEU | Elongation factor Tu OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=tuf1 PE=3 SV=1 | 280 | 604 | 2.0E-09 |
sp|Q7U4D1|EFTU_SYNPX | Elongation factor Tu OS=Synechococcus sp. (strain WH8102) GN=tuf PE=3 SV=1 | 280 | 604 | 2.0E-09 |
sp|P40175|EFTU3_STRCO | Elongation factor Tu-3 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=tuf3 PE=3 SV=2 | 280 | 604 | 2.0E-09 |
sp|B1WQY4|EFTU_CYAA5 | Elongation factor Tu OS=Cyanothece sp. (strain ATCC 51142) GN=tuf PE=3 SV=1 | 192 | 604 | 2.0E-09 |
sp|Q07KJ2|EFTU_RHOP5 | Elongation factor Tu OS=Rhodopseudomonas palustris (strain BisA53) GN=tuf1 PE=3 SV=1 | 192 | 604 | 2.0E-09 |
sp|Q8R7V2|EFTU1_CALS4 | Elongation factor Tu-A OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=tufA PE=3 SV=1 | 246 | 604 | 2.0E-09 |
sp|Q41803|EF1A_MAIZE | Elongation factor 1-alpha OS=Zea mays GN=EF1A PE=3 SV=1 | 192 | 608 | 2.0E-09 |
sp|Q826Z7|EFTU2_STRAW | Elongation factor Tu 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=tuf2 PE=3 SV=1 | 280 | 604 | 3.0E-09 |
sp|A6W5T5|EFTU_KINRD | Elongation factor Tu OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=tuf PE=3 SV=1 | 192 | 601 | 3.0E-09 |
sp|B8I5N8|EFTU_CLOCE | Elongation factor Tu OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=tuf PE=3 SV=1 | 192 | 604 | 3.0E-09 |
sp|Q1BDD3|EFTU_MYCSS | Elongation factor Tu OS=Mycobacterium sp. (strain MCS) GN=tuf PE=3 SV=1 | 280 | 604 | 3.0E-09 |
sp|A1UBL1|EFTU_MYCSK | Elongation factor Tu OS=Mycobacterium sp. (strain KMS) GN=tuf PE=3 SV=1 | 280 | 604 | 3.0E-09 |
sp|A3PV96|EFTU_MYCSJ | Elongation factor Tu OS=Mycobacterium sp. (strain JLS) GN=tuf PE=3 SV=1 | 280 | 604 | 3.0E-09 |
sp|A7NR65|EFTU1_ROSCS | Elongation factor Tu 1 OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=tuf1 PE=3 SV=1 | 261 | 604 | 3.0E-09 |
sp|A8EW02|EFTU_ARCB4 | Elongation factor Tu OS=Arcobacter butzleri (strain RM4018) GN=tuf PE=3 SV=1 | 218 | 604 | 3.0E-09 |
sp|Q877P8|EFTU_XYLFT | Elongation factor Tu OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=tufA PE=3 SV=2 | 280 | 604 | 3.0E-09 |
sp|Q9P9Q9|EFTU_XYLFA | Elongation factor Tu OS=Xylella fastidiosa (strain 9a5c) GN=tufA PE=1 SV=3 | 280 | 604 | 3.0E-09 |
sp|Q3AMT6|EFTU_SYNSC | Elongation factor Tu OS=Synechococcus sp. (strain CC9605) GN=tuf PE=3 SV=1 | 280 | 604 | 3.0E-09 |
sp|A8HTW6|EFTU_AZOC5 | Elongation factor Tu OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=tuf1 PE=3 SV=1 | 192 | 604 | 4.0E-09 |
sp|Q123F6|EFTU_POLSJ | Elongation factor Tu OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=tuf1 PE=3 SV=1 | 232 | 604 | 4.0E-09 |
sp|A4T1R2|EFTU_MYCGI | Elongation factor Tu OS=Mycobacterium gilvum (strain PYR-GCK) GN=tuf PE=3 SV=1 | 280 | 604 | 4.0E-09 |
sp|B2J5B1|EFTU_NOSP7 | Elongation factor Tu OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=tuf PE=3 SV=1 | 280 | 604 | 4.0E-09 |
sp|Q6LLV5|EFTU2_PHOPR | Elongation factor Tu 2 OS=Photobacterium profundum GN=tuf2 PE=3 SV=2 | 192 | 604 | 4.0E-09 |
sp|Q1IHG6|EFTU_KORVE | Elongation factor Tu OS=Koribacter versatilis (strain Ellin345) GN=tuf1 PE=3 SV=1 | 280 | 604 | 4.0E-09 |
sp|B0BBV3|EFTU_CHLTB | Elongation factor Tu OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=tuf PE=3 SV=1 | 192 | 604 | 4.0E-09 |
sp|B0B7N8|EFTU_CHLT2 | Elongation factor Tu OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=tuf PE=1 SV=1 | 192 | 604 | 4.0E-09 |
sp|P18906|EFTU_MYCGA | Elongation factor Tu OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=tuf PE=3 SV=1 | 280 | 604 | 4.0E-09 |
sp|B0T2B5|EFTU2_CAUSK | Elongation factor Tu 2 OS=Caulobacter sp. (strain K31) GN=tuf2 PE=3 SV=1 | 263 | 604 | 5.0E-09 |
sp|Q6AP73|EFTU2_DESPS | Elongation factor Tu 2 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=tuf2 PE=3 SV=1 | 263 | 604 | 5.0E-09 |
sp|B1KSM7|EFTU_CLOBM | Elongation factor Tu OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=tuf1 PE=3 SV=1 | 252 | 604 | 5.0E-09 |
sp|B9E8Q0|EFTU_MACCJ | Elongation factor Tu OS=Macrococcus caseolyticus (strain JCSC5402) GN=tuf PE=3 SV=1 | 280 | 604 | 5.0E-09 |
sp|Q7VJ74|EFTU_HELHP | Elongation factor Tu OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=tuf PE=3 SV=1 | 280 | 604 | 5.0E-09 |
sp|P40174|EFTU1_STRCO | Elongation factor Tu-1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=tuf1 PE=3 SV=1 | 243 | 604 | 5.0E-09 |
sp|Q2RQU6|EFTU2_RHORT | Elongation factor Tu 2 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=tuf2 PE=3 SV=1 | 192 | 604 | 5.0E-09 |
sp|Q01698|EFTU_THEAQ | Elongation factor Tu OS=Thermus aquaticus GN=tuf PE=1 SV=2 | 277 | 604 | 6.0E-09 |
sp|Q0I0B9|EFTU1_SHESR | Elongation factor Tu 1 OS=Shewanella sp. (strain MR-7) GN=tuf1 PE=3 SV=1 | 192 | 604 | 6.0E-09 |
sp|Q0HNV1|EFTU1_SHESM | Elongation factor Tu 1 OS=Shewanella sp. (strain MR-4) GN=tuf1 PE=3 SV=1 | 192 | 604 | 6.0E-09 |
sp|Q12SW1|EFTU_SHEDO | Elongation factor Tu OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=tuf PE=3 SV=1 | 254 | 604 | 6.0E-09 |
sp|Q2NQL7|EFTU_SODGM | Elongation factor Tu OS=Sodalis glossinidius (strain morsitans) GN=tuf1 PE=3 SV=1 | 280 | 604 | 6.0E-09 |
sp|P60338|EFTU1_THETH | Elongation factor Tu-A OS=Thermus thermophilus GN=tufA PE=1 SV=2 | 277 | 604 | 7.0E-09 |
sp|Q5SHN6|EFTU1_THET8 | Elongation factor Tu-A OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=tufA PE=1 SV=3 | 277 | 604 | 7.0E-09 |
sp|Q605B0|EFTU_METCA | Elongation factor Tu OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=tuf1 PE=3 SV=1 | 192 | 604 | 7.0E-09 |
sp|Q3A6P9|EFTU2_PELCD | Elongation factor Tu 2 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=tuf2 PE=3 SV=1 | 280 | 604 | 7.0E-09 |
sp|Q2EEV7|EFTU_HELSJ | Elongation factor Tu, plastid OS=Helicosporidium sp. subsp. Simulium jonesii GN=tufA PE=3 SV=2 | 280 | 601 | 8.0E-09 |
sp|Q4FLK5|EFTU_PELUB | Elongation factor Tu OS=Pelagibacter ubique (strain HTCC1062) GN=tuf PE=3 SV=1 | 280 | 604 | 8.0E-09 |
sp|Q49V58|EFTU_STAS1 | Elongation factor Tu OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=tuf PE=3 SV=1 | 280 | 604 | 8.0E-09 |
sp|B0UV21|EFTU_HISS2 | Elongation factor Tu OS=Histophilus somni (strain 2336) GN=tuf PE=3 SV=1 | 280 | 604 | 8.0E-09 |
sp|Q0I1U9|EFTU_HAES1 | Elongation factor Tu OS=Haemophilus somnus (strain 129Pt) GN=tuf1 PE=3 SV=1 | 280 | 604 | 8.0E-09 |
sp|P59506|EFTU_BUCBP | Elongation factor Tu OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=tuf PE=3 SV=1 | 280 | 604 | 8.0E-09 |
sp|A1AX82|EFTU2_RUTMC | Elongation factor Tu 2 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=tuf2 PE=3 SV=1 | 192 | 604 | 8.0E-09 |
sp|Q72GW4|EFTU_THET2 | Elongation factor Tu OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=tuf1 PE=3 SV=1 | 277 | 604 | 8.0E-09 |
sp|P29543|EFTU2_STRRA | Elongation factor Tu-2 OS=Streptomyces ramocissimus GN=tuf2 PE=3 SV=1 | 272 | 604 | 9.0E-09 |
sp|A0KRL0|EFTU_SHESA | Elongation factor Tu OS=Shewanella sp. (strain ANA-3) GN=tuf1 PE=3 SV=1 | 192 | 604 | 9.0E-09 |
sp|Q3MDM5|EFTU_ANAVT | Elongation factor Tu OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=tuf PE=3 SV=1 | 280 | 604 | 9.0E-09 |
sp|P60339|EFTU2_THET8 | Elongation factor Tu-B OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=tufB PE=1 SV=2 | 280 | 604 | 1.0E-08 |
sp|Q3SLQ1|EFTU_THIDA | Elongation factor Tu OS=Thiobacillus denitrificans (strain ATCC 25259) GN=tuf1 PE=3 SV=1 | 280 | 604 | 1.0E-08 |
sp|Q2W2H3|EFTU_MAGSA | Elongation factor Tu OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=tuf1 PE=3 SV=1 | 192 | 604 | 1.0E-08 |
sp|Q8YP63|EFTU_NOSS1 | Elongation factor Tu OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=tuf PE=1 SV=1 | 280 | 604 | 1.0E-08 |
sp|Q9TJQ8|EFTU_PROWI | Elongation factor Tu, plastid OS=Prototheca wickerhamii GN=tufA PE=3 SV=1 | 192 | 601 | 1.0E-08 |
sp|A6LPP6|EFTU_CLOB8 | Elongation factor Tu OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=tuf1 PE=3 SV=1 | 280 | 604 | 1.0E-08 |
sp|A3M1F6|EFTU_ACIBT | Elongation factor Tu OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=tuf1 PE=3 SV=2 | 280 | 604 | 1.0E-08 |
sp|B7H1K5|EFTU_ACIB3 | Elongation factor Tu OS=Acinetobacter baumannii (strain AB307-0294) GN=tuf PE=3 SV=1 | 280 | 604 | 1.0E-08 |
sp|Q981F7|EFTU_RHILO | Elongation factor Tu OS=Rhizobium loti (strain MAFF303099) GN=tufA PE=3 SV=1 | 263 | 601 | 1.0E-08 |
sp|P14081|SELB_ECOLI | Selenocysteine-specific elongation factor OS=Escherichia coli (strain K12) GN=selB PE=1 SV=3 | 192 | 592 | 1.0E-08 |
sp|A6Q6H4|EFTU_SULNB | Elongation factor Tu OS=Sulfurovum sp. (strain NBC37-1) GN=tuf PE=3 SV=1 | 243 | 604 | 1.0E-08 |
sp|B9DKV8|EFTU_STACT | Elongation factor Tu OS=Staphylococcus carnosus (strain TM300) GN=tuf PE=3 SV=1 | 280 | 604 | 1.0E-08 |
sp|Q7VRP0|EFTU_BLOFL | Elongation factor Tu OS=Blochmannia floridanus GN=tuf PE=3 SV=1 | 280 | 604 | 1.0E-08 |
sp|Q38WR7|EFTU_LACSS | Elongation factor Tu OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=tuf PE=3 SV=1 | 192 | 604 | 1.0E-08 |
sp|Q0AIJ7|EFTU1_NITEC | Elongation factor Tu 1 OS=Nitrosomonas eutropha (strain C91) GN=tuf1 PE=3 SV=1 | 279 | 604 | 1.0E-08 |
sp|B8ELG5|EFTU_METSB | Elongation factor Tu OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=tuf PE=3 SV=1 | 192 | 604 | 1.0E-08 |
sp|Q0AF46|EFTU2_NITEC | Elongation factor Tu 2 OS=Nitrosomonas eutropha (strain C91) GN=tuf2 PE=3 SV=1 | 279 | 604 | 1.0E-08 |
GO Term | Description | Terminal node |
---|---|---|
GO:0005525 | GTP binding | Yes |
GO:0003924 | GTPase activity | Yes |
GO:0032553 | ribonucleotide binding | No |
GO:0016462 | pyrophosphatase activity | No |
GO:0003674 | molecular_function | No |
GO:0032550 | purine ribonucleoside binding | No |
GO:0001883 | purine nucleoside binding | No |
GO:0036094 | small molecule binding | No |
GO:1901265 | nucleoside phosphate binding | No |
GO:0005488 | binding | No |
GO:0032549 | ribonucleoside binding | No |
GO:0097159 | organic cyclic compound binding | No |
GO:0019001 | guanyl nucleotide binding | No |
GO:0016817 | hydrolase activity, acting on acid anhydrides | No |
GO:0017076 | purine nucleotide binding | No |
GO:0035639 | purine ribonucleoside triphosphate binding | No |
GO:0032555 | purine ribonucleotide binding | No |
GO:0017111 | nucleoside-triphosphatase activity | No |
GO:0016818 | hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides | No |
GO:0016787 | hydrolase activity | No |
GO:0032561 | guanyl ribonucleotide binding | No |
GO:0003824 | catalytic activity | No |
GO:0097367 | carbohydrate derivative binding | No |
GO:0043168 | anion binding | No |
GO:0043167 | ion binding | No |
GO:0000166 | nucleotide binding | No |
GO:1901363 | heterocyclic compound binding | No |
GO:0001882 | nucleoside binding | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 65 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Hirsu2|10052 MSNKINKAQTHEKRKGESALSDFAEYAEQQQNLRFPAARRAAASDTTAGAGPADHHDELDELFDNLELADTAPRI PLKDLLLGSDEDSLKGLEDAVAERVEEGMGEAVFELGYENNGDSMRFTPDQWTVAYERLVKAAKGIGADCELLLT KNVGGQVEAASTVPAGKDTACSGKVLVRRVPSKAEDAIETRIAVVGNVDAGKSSMLGVLVKGDLDDGRGKARVNL FRHKHEIETGRTSSVGMEIMGFDSVGRVITSDTPGRKLSWEDIGKRSAKVITFTDLAGHEKYLRTTVFGLLSSSP NYCLLMVAANNGLVGMSKEHLGIALALNVPVMVVVTKIDICPPNILAETIGQISKIMRSPGARKVPTFIKTREDC INTATQFVSHRICPVFQVSNVTGENLELVRTFLNILPHHGRYNTDAPLEFHVNDTFSVPFTGTVVSGIVKSGVAH EGDSVVIGPDSLGQFTHTAIRSIERKRIRVPAASAGQSASFALKKVKRRDVRKGMVVLPKLEGQPVPRVHREFVA EVLILSHATTIQTKYQAMLHVGSVSQTCAIIDIDRELIRTGDRATVAFRFEQRPEYLVPGDRLLFREGRTKGLGI VKAVGYDPQRPLMPRPAAANGRRRTG* |
Coding | >Hirsu2|10052 ATGTCAAACAAGATCAACAAAGCGCAGACGCATGAGAAGCGCAAGGGAGAGTCGGCTCTGAGCGACTTCGCCGAG TACGCCGAACAGCAGCAGAACCTCCGCTTCCCGGCGGCCAGACGAGCCGCCGCCTCCGACACGACCGCCGGTGCC GGGCCAGCAGACCACCATGACGAGCTGGATGAGCTCTTCGACAACCTGGAACTAGCCGACACGGCCCCCAGGATA CCGCTCAAGGACCTCCTGCTCGGATCGGACGAGGATTCCCTTAAGGGCCTCGAAGACGCCGTGGCCGAGCGGGTC GAAGAAGGGATGGGCGAGGCCGTCTTCGAACTAGGGTACGAGAACAACGGCGACTCGATGCGCTTCACGCCAGAC CAATGGACCGTCGCGTACGAGAGACTGGTGAAAGCGGCCAAGGGCATAGGTGCCGACTGCGAGCTCCTGCTGACC AAGAATGTCGGTGGCCAAGTGGAAGCGGCCAGCACGGTGCCGGCCGGCAAGGACACCGCGTGTAGCGGCAAGGTG CTCGTCCGTCGAGTGCCATCCAAGGCAGAAGACGCCATCGAGACGAGGATAGCGGTCGTTGGAAACGTCGATGCG GGAAAGAGTTCCATGCTCGGCGTGCTGGTCAAGGGCGACCTGGACGACGGGCGGGGCAAGGCCCGAGTGAATCTG TTCCGGCACAAGCACGAGATCGAGACGGGCCGGACAAGCTCAGTGGGCATGGAGATTATGGGATTCGACAGCGTG GGACGAGTCATCACCTCCGATACTCCAGGCCGCAAGCTCTCGTGGGAGGACATCGGCAAGAGGAGCGCCAAGGTC ATCACGTTCACGGACCTGGCGGGCCATGAAAAGTACCTGCGGACGACGGTGTTCGGCCTGCTGTCGAGCAGCCCC AACTACTGCCTACTGATGGTGGCGGCCAACAACGGGCTAGTCGGGATGAGCAAGGAGCACCTGGGCATCGCGCTG GCGCTCAACGTGCCGGTCATGGTGGTGGTGACCAAGATCGACATCTGCCCGCCCAACATCCTGGCCGAGACCATC GGGCAGATCAGCAAGATCATGCGCAGCCCCGGGGCGCGCAAGGTGCCGACCTTCATCAAGACGCGCGAGGACTGC ATCAACACGGCGACGCAGTTCGTCAGCCACCGCATCTGCCCCGTCTTCCAGGTCTCCAACGTGACGGGCGAGAAC CTGGAGCTGGTGCGGACCTTCCTCAACATCCTGCCGCACCACGGCCGCTACAACACGGACGCGCCGCTCGAGTTC CACGTCAACGACACCTTCTCGGTCCCCTTCACCGGCACCGTCGTCTCCGGCATCGTCAAGTCGGGCGTCGCGCAC GAGGGCGACAGCGTCGTCATCGGGCCCGACTCGCTCGGCCAGTTCACCCACACCGCCATCCGCTCCATCGAGCGC AAGCGCATCCGCGTGCCCGCCGCCTCGGCCGGCCAGTCGGCCTCGTTCGCCCTCAAGAAGGTGAAGCGCCGCGAC GTGCGCAAGGGCATGGTGGTGCTGCCCAAGCTCGAGGGCCAGCCCGTGCCGCGCGTGCACCGCGAGTTTGTGGCC GAAGTCCTCATCCTCTCGCACGCGACGACGATCCAGACCAAGTACCAGGCCATGCTGCACGTCGGCTCCGTCTCG CAGACGTGCGCCATCATCGACATCGACCGCGAGCTTATCCGCACCGGCGACCGCGCCACCGTCGCCTTCCGCTTC GAGCAGCGGCCCGAGTACCTCGTCCCGGGCGACCGCCTGCTCTTCCGCGAGGGCCGCACCAAGGGCCTCGGCATC GTCAAGGCCGTCGGCTACGACCCGCAGCGCCCGCTCATGCCCCGGCCCGCCGCCGCCAACGGCCGGAGGAGGACT GGCTAG |
Transcript | >Hirsu2|10052 ATGTCAAACAAGATCAACAAAGCGCAGACGCATGAGAAGCGCAAGGGAGAGTCGGCTCTGAGCGACTTCGCCGAG TACGCCGAACAGCAGCAGAACCTCCGCTTCCCGGCGGCCAGACGAGCCGCCGCCTCCGACACGACCGCCGGTGCC GGGCCAGCAGACCACCATGACGAGCTGGATGAGCTCTTCGACAACCTGGAACTAGCCGACACGGCCCCCAGGATA CCGCTCAAGGACCTCCTGCTCGGATCGGACGAGGATTCCCTTAAGGGCCTCGAAGACGCCGTGGCCGAGCGGGTC GAAGAAGGGATGGGCGAGGCCGTCTTCGAACTAGGGTACGAGAACAACGGCGACTCGATGCGCTTCACGCCAGAC CAATGGACCGTCGCGTACGAGAGACTGGTGAAAGCGGCCAAGGGCATAGGTGCCGACTGCGAGCTCCTGCTGACC AAGAATGTCGGTGGCCAAGTGGAAGCGGCCAGCACGGTGCCGGCCGGCAAGGACACCGCGTGTAGCGGCAAGGTG CTCGTCCGTCGAGTGCCATCCAAGGCAGAAGACGCCATCGAGACGAGGATAGCGGTCGTTGGAAACGTCGATGCG GGAAAGAGTTCCATGCTCGGCGTGCTGGTCAAGGGCGACCTGGACGACGGGCGGGGCAAGGCCCGAGTGAATCTG TTCCGGCACAAGCACGAGATCGAGACGGGCCGGACAAGCTCAGTGGGCATGGAGATTATGGGATTCGACAGCGTG GGACGAGTCATCACCTCCGATACTCCAGGCCGCAAGCTCTCGTGGGAGGACATCGGCAAGAGGAGCGCCAAGGTC ATCACGTTCACGGACCTGGCGGGCCATGAAAAGTACCTGCGGACGACGGTGTTCGGCCTGCTGTCGAGCAGCCCC AACTACTGCCTACTGATGGTGGCGGCCAACAACGGGCTAGTCGGGATGAGCAAGGAGCACCTGGGCATCGCGCTG GCGCTCAACGTGCCGGTCATGGTGGTGGTGACCAAGATCGACATCTGCCCGCCCAACATCCTGGCCGAGACCATC GGGCAGATCAGCAAGATCATGCGCAGCCCCGGGGCGCGCAAGGTGCCGACCTTCATCAAGACGCGCGAGGACTGC ATCAACACGGCGACGCAGTTCGTCAGCCACCGCATCTGCCCCGTCTTCCAGGTCTCCAACGTGACGGGCGAGAAC CTGGAGCTGGTGCGGACCTTCCTCAACATCCTGCCGCACCACGGCCGCTACAACACGGACGCGCCGCTCGAGTTC CACGTCAACGACACCTTCTCGGTCCCCTTCACCGGCACCGTCGTCTCCGGCATCGTCAAGTCGGGCGTCGCGCAC GAGGGCGACAGCGTCGTCATCGGGCCCGACTCGCTCGGCCAGTTCACCCACACCGCCATCCGCTCCATCGAGCGC AAGCGCATCCGCGTGCCCGCCGCCTCGGCCGGCCAGTCGGCCTCGTTCGCCCTCAAGAAGGTGAAGCGCCGCGAC GTGCGCAAGGGCATGGTGGTGCTGCCCAAGCTCGAGGGCCAGCCCGTGCCGCGCGTGCACCGCGAGTTTGTGGCC GAAGTCCTCATCCTCTCGCACGCGACGACGATCCAGACCAAGTACCAGGCCATGCTGCACGTCGGCTCCGTCTCG CAGACGTGCGCCATCATCGACATCGACCGCGAGCTTATCCGCACCGGCGACCGCGCCACCGTCGCCTTCCGCTTC GAGCAGCGGCCCGAGTACCTCGTCCCGGGCGACCGCCTGCTCTTCCGCGAGGGCCGCACCAAGGGCCTCGGCATC GTCAAGGCCGTCGGCTACGACCCGCAGCGCCCGCTCATGCCCCGGCCCGCCGCCGCCAACGGCCGGAGGAGGACT GGCTAG |
Gene | >Hirsu2|10052 ATGTCAAACAAGATCAACAAAGCGCAGACGCATGAGAAGCGCAAGGGAGAGTCGGTACGGTGCTTGATGCGTCCT TCAAACGATTGGAGATGCCGCCGTCTCACATAGTCCGCAGGCTCTGAGCGACTTCGCCGAGTACGCCGAACAGCA GCAGAACCTCCGCTTCCCGGCGGCCAGACGAGCCGCCGCCTCCGACACGACCGCCGGTGCCGGGCCAGCAGACCA CCATGACGAGCTGGATGAGCTCTTCGACAACCTGGAACTAGCCGACACGGCCCCCAGGATACCGCTCAAGGACCT CCTGCTCGGATCGGACGAGGATTCCCTTAAGGGCCTCGAAGACGCCGTGGCCGAGCGGGTCGAAGAAGGGATGGG CGAGGCCGTCTTCGAACTAGGGTACGAGAACAACGGCGACTCGATGCGCTTCACGCCAGACCAATGGACCGTCGC GTACGAGAGACTGGTGAAAGCGGCCAAGGGCATAGGTGCCGACTGCGAGCTCCTGCTGACCAAGAATGTCGGTGG CCAAGTGGAAGCGGCCAGCACGGTGCCGGCCGGCAAGGACACCGCGTGTAGCGGCAAGGTGCTCGTCCGTCGAGT GCCATCCAAGGCAGAAGACGCCATCGAGACGAGGATAGCGGTCGTTGGAAACGGTAAGCCGAGTCCTGGAGCGGT TCCGCCACCGACCATTCCAAGACGCTGACGCGCGGCGAAACCCCCCCAGTCGATGCGGGAAAGAGTTCCATGCTC GGCGTGCTGGTCAAGGGCGACCTGGACGACGGGCGGGGCAAGGCCCGAGTGAATCTGTTCCGGCACAAGCACGAG ATCGAGACGGGCCGGACAAGCTCAGTGGGCATGGAGATTATGGGATTCGACAGCGTGGGACGAGTCATCACCTCC GATACTCCAGGCCGTGAGTCCCGCCAGGACTTTTTCTCTCTCTCTCTCAGGCGTCGTGCGGCCGCTGACATGATG AGCCTCTCTCGCAAGGCAAGCTCTCGTGGGAGGACATCGGCAAGAGGAGCGCCAAGGTCATCACGTTCACGGACC TGGCGGGCCATGAAAAGTACCTGCGGACGACGGTGTTCGGCCTGCTGTCGAGCAGCCCCAACTACTGCCTACTGA TGGTGGCGGCCAACAACGGGCTAGTCGGGATGAGCAAGGAGCACCTGGGCATCGCGCTGGCGCTCAACGTGCCGG TCATGGTGGTGGTGACCAAGATCGACATCTGCCCGCCCAACATCCTGGCCGAGACCATCGGGCAGATCAGCAAGA TCATGCGCAGCCCCGGGGCGCGCAAGGTGCCGACCTTCATCAAGACGCGCGAGGACTGCATCAACACGGCGACGC AGTTCGTCAGCCACCGCATCTGCCCCGTCTTCCAGGTCTCCAACGTGACGGGCGAGAACCTGGAGCTGGTGCGGA CCTTCCTCAACATCCTGCCGCACCACGGCCGCTACAACACGGACGCGCCGCTCGAGTTCCACGTCAACGACACCT TCTCGGTCCCCTTCACCGGCACCGTCGTCTCCGGCATCGTCAAGTCGGGCGTCGCGCACGAGGGCGACAGCGTCG TCATCGGGCCCGACTCGCTCGGCCAGTTCACCCACACCGCCATCCGCTCCATCGAGCGCAAGCGCATCCGCGTGC CCGCCGCCTCGGCCGGCCAGTCGGCCTCGTTCGCCCTCAAGAAGGTGAAGCGCCGCGACGTGCGCAAGGGCATGG TGGTGCTGCCCAAGCTCGAGGGCCAGCCCGTGCCGCGCGTGCACCGCGAGTTTGTGGCCGAAGGTGAGTCGCATA GAGAGAGAAAATACACACACACACACACAGAGAGAGAGAGAGAGAGAGGAGAGAGAAGGGGGGCGGCGCGGCTGA CGGTCCTCCAAACTCACACAAGTCCTCATCCTCTCGCACGCGACGACGATCCAGACCAAGTACCAGGCCATGCTG CACGTCGGCTCCGTCTCGCAGACGTGCGCCATCATCGACATCGACCGCGAGCTTATCCGCACCGGCGACCGCGCC ACCGTCGCCTTCCGCTTCGAGCAGCGGCCCGAGTACCTCGTCCCGGGCGACCGCCTGCTCTTCCGCGAGGGCCGC ACCAAGGGCCTCGGCATCGTCAAGGCCGTCGGCTACGACCCGCAGCGCCCGCTCATGCCCCGGCCCGCCGCCGCC AACGGCCGGAGGAGGACTGGCTAG |