Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10051
Gene name
LocationContig_78:32472..35752
Strand+
Gene length (bp)3280
Transcript length (bp)3198
Coding sequence length (bp)3198
Protein length (aa) 1066

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02752 Arrestin_C Arrestin (or S-antigen), C-terminal domain 5.3E-16 618 834

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74798|ALY2_SCHPO Putative arrestin-related trafficking adapter C2D10.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2D10.04 PE=1 SV=1 348 1038 1.0E-68
sp|P36117|ALY1_YEAST Arrestin-related trafficking adapter 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALY1 PE=1 SV=1 360 846 1.0E-54
sp|P47029|ALY2_YEAST Arrestin-related trafficking adapter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALY2 PE=1 SV=2 518 856 9.0E-53
sp|Q8WZK5|ALY1_SCHPO Putative arrestin-related trafficking adapter C839.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC839.02 PE=3 SV=1 361 847 1.0E-49
sp|Q02805|ROD1_YEAST Protein ROD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROD1 PE=1 SV=1 396 666 3.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74798|ALY2_SCHPO Putative arrestin-related trafficking adapter C2D10.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2D10.04 PE=1 SV=1 348 1038 1.0E-68
sp|P36117|ALY1_YEAST Arrestin-related trafficking adapter 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALY1 PE=1 SV=1 360 846 1.0E-54
sp|P47029|ALY2_YEAST Arrestin-related trafficking adapter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALY2 PE=1 SV=2 518 856 9.0E-53
sp|Q8WZK5|ALY1_SCHPO Putative arrestin-related trafficking adapter C839.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC839.02 PE=3 SV=1 361 847 1.0E-49
sp|Q02805|ROD1_YEAST Protein ROD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROD1 PE=1 SV=1 396 666 3.0E-12
sp|P47029|ALY2_YEAST Arrestin-related trafficking adapter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALY2 PE=1 SV=2 360 443 1.0E-10
sp|Q09729|YA4C_SCHPO Arrestin domain-containing protein C31A2.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC31A2.12 PE=1 SV=1 546 664 6.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10051
MSAPPRQGRSRNGNWIISNGGNVFYRVDTLARDAAAPPAQQPSPSLPAPLIGPRRTRPHAIHIITYPPGYVPREL
RPKPPSRSSKAAQSLRARSKIAAKLGRPDDNGCETPSGKRRSHLQQSPVLGKLFASFTSSASRAISSSSSSSSAS
PSPLSSAVASTPPSDESRPQSSPTAGPAGTGIRIPRQAAAYDEVGSTDPANIDAQSPRIDERRRQRHRLSLPLPQ
ALSALRRRDDASSGTPSGTPGGTAAAPTLRSLTTDRVLAASPSPFPASSPIAGRVTPTTRASTPTTTTRATNTPT
RTAMAAIATPAAYHLGGAGGSAGAIGVGAGSSGGSNRNSIMSIRSAKSTVSSLVAEVPKPVASGSGVSCSILLAE
PNVFLTGFDHEHDLQREGHSGGTALLRGKLHLSISKNVKIKAVQLKLLGRARTEWPEGIPPLKQDMVEEESLRTQ
VLTFFNAMNDGWETEYGNQCTYQLRAASANSSSTNLAALPRVTGLAPASAANRGGLTAKELKRLSLQSVQSRSFG
KGESGVTAPTQAKGFKVFYPGTYDYSFELPIDHHQLETTKLQYGSVRWELHATVDRAGAFKPNLHGMKEVPIVRL
PDQMSLETTEPISISRQWEDQLHYDIVISGKSFSIGSKIPIAFKLTPLAKVQVHKLKVYVTETIEYWTNDRRVTR
KEPGRKILLLEKSAGKPLDANWASSDITTVRGGEPTTEARRDARELAQRRRNAEAARAHRSPEPLPEPAANLLGD
LDLGLESMWGSTEIEANVQIPTCEMMAKNKELRLHPDCSWKNVNVYHWIKIVMRISRIDPEDPSGTKRRHFEISI
DSPFTVLNCRATQANTNLPAYSGPICHPAPFQAACGCPDAATVATNISPSSSTGTLLAVEMVNDMLPTPPQAAYL
TSPTAANPACEPQSPSRASAEDAGSHSDPRPIHLLRAPSFDPPAFTADVAPPPAIFVEEPPVVTPPPQYDTVVGT
PSVDGLADYFSRLADYGLRNGEDSGSDSDETPSRILDRSGRVNVSHPRTPGRRMPSRSMEIARPPLRLNLDSLPD
RSRASVTPAASGAAA*
Coding >Hirsu2|10051
ATGTCAGCGCCGCCACGACAGGGTCGTTCCCGCAACGGTAATTGGATCATCTCCAACGGCGGAAACGTCTTCTAC
CGCGTCGATACCCTCGCCCGGGACGCCGCCGCGCCTCCAGCACAGCAGCCGTCTCCGAGCTTGCCGGCGCCCCTC
ATCGGGCCTCGGCGTACGCGGCCGCACGCAATCCACATCATCACCTATCCGCCCGGCTACGTCCCGCGCGAGCTG
CGTCCGAAACCCCCCAGCAGATCCAGCAAGGCCGCCCAGTCACTCAGGGCCCGCTCCAAGATTGCCGCCAAGCTC
GGCCGCCCCGACGACAACGGCTGCGAGACGCCGAGCGGCAAGAGGAGGAGCCATCTACAGCAGTCACCGGTCTTG
GGCAAGCTGTTCGCCTCCTTCACCTCGAGCGCCTCGCGCGCCATCTCGTCGTCGTCTTCGTCCTCATCAGCCTCC
CCCTCGCCTCTGTCGTCCGCCGTCGCGTCGACACCGCCCTCGGACGAGTCGAGACCGCAATCCAGCCCAACGGCG
GGCCCCGCGGGGACAGGGATCAGGATCCCACGCCAAGCGGCAGCCTATGACGAAGTAGGCTCTACCGATCCCGCC
AACATCGACGCCCAGAGCCCACGAATCGACGAGCGCCGCCGTCAGCGTCACCGCCTGAGCCTTCCACTGCCGCAG
GCCCTGTCGGCTCTGCGCCGACGAGACGACGCCTCGAGCGGGACCCCAAGCGGGACCCCCGGCGGCACCGCGGCT
GCGCCCACGCTCAGGTCGCTGACAACCGACCGCGTCCTCGCCGCCTCGCCCTCGCCCTTCCCCGCATCTTCTCCC
ATCGCCGGCAGAGTCACGCCGACGACGAGGGCGTCGACCCCCACGACCACCACGAGAGCCACCAACACCCCGACG
CGCACCGCCATGGCCGCCATCGCCACCCCGGCGGCCTACCATCTCGGCGGTGCTGGTGGCAGCGCCGGTGCTATC
GGGGTCGGCGCTGGCAGCAGCGGCGGCAGCAACCGCAATAGCATCATGTCTATCCGCTCCGCCAAGTCGACCGTC
AGCTCCCTCGTCGCCGAGGTGCCGAAACCCGTTGCCTCCGGCAGCGGCGTCTCCTGCTCCATCCTTCTGGCCGAG
CCAAACGTCTTCCTCACCGGCTTTGACCACGAGCATGATCTGCAGCGCGAGGGCCACAGCGGCGGCACTGCCCTC
CTGCGCGGCAAGCTGCACCTCTCCATCAGCAAAAACGTAAAGATCAAGGCCGTTCAGCTCAAGCTACTCGGCCGC
GCCCGCACCGAGTGGCCTGAGGGCATCCCTCCGCTCAAGCAGGACATGGTCGAGGAGGAGAGTCTGCGGACTCAG
GTCCTGACCTTCTTCAACGCCATGAACGATGGCTGGGAGACCGAGTACGGCAATCAGTGCACGTACCAGCTCCGC
GCCGCCTCGGCCAATTCCTCCTCCACCAACCTGGCCGCTCTGCCTCGCGTCACCGGCCTCGCCCCCGCCTCCGCC
GCGAACCGCGGCGGTCTCACCGCCAAAGAGCTCAAGCGCCTCTCCCTCCAAAGCGTCCAGTCGCGCAGTTTCGGC
AAAGGCGAGAGCGGCGTCACCGCCCCGACCCAGGCCAAGGGTTTCAAGGTCTTCTACCCGGGCACGTACGACTAC
TCCTTCGAGCTCCCCATCGACCACCACCAGCTCGAGACGACCAAGCTGCAGTACGGCTCCGTCCGCTGGGAGCTG
CACGCCACCGTCGACCGCGCCGGCGCATTCAAGCCCAACCTACACGGCATGAAGGAGGTTCCCATCGTCCGCCTG
CCCGACCAGATGTCTCTCGAGACCACCGAGCCAATCTCCATCAGCCGCCAGTGGGAGGATCAGCTGCACTACGAC
ATCGTCATTTCCGGCAAGAGCTTCTCCATCGGTTCCAAGATACCCATCGCCTTTAAGCTCACCCCATTAGCCAAG
GTTCAGGTCCACAAGCTTAAAGTCTACGTCACCGAGACCATTGAATATTGGACGAACGACCGCCGCGTTACGCGC
AAAGAACCGGGCCGTAAGATCCTGCTGCTCGAGAAGTCGGCCGGCAAGCCGCTCGACGCCAATTGGGCCTCGTCC
GACATCACCACCGTCCGGGGTGGCGAGCCCACCACCGAGGCTCGCCGCGACGCCCGCGAGCTGGCCCAACGAAGG
CGCAATGCCGAGGCGGCCCGCGCCCACCGTTCGCCCGAGCCCCTACCCGAGCCTGCGGCCAACCTACTCGGTGAT
CTCGACCTCGGCCTCGAGAGCATGTGGGGCTCGACCGAGATCGAGGCTAACGTCCAGATCCCGACATGCGAGATG
ATGGCCAAGAACAAGGAGCTGAGACTGCATCCGGACTGCAGCTGGAAGAATGTCAATGTCTATCACTGGATCAAG
ATCGTCATGCGCATCAGCCGCATAGACCCCGAGGACCCGTCGGGCACGAAACGGCGACACTTTGAAATCAGCATC
GACTCTCCCTTCACCGTCCTCAACTGCCGGGCGACGCAGGCCAACACCAATCTGCCTGCCTACTCGGGTCCCATC
TGCCACCCCGCGCCCTTCCAGGCGGCCTGCGGCTGCCCGGACGCGGCCACGGTGGCCACCAACATTTCGCCCAGC
TCGTCGACCGGCACGCTGCTGGCGGTCGAGATGGTCAACGACATGCTCCCGACGCCTCCGCAGGCGGCGTACCTC
ACGAGCCCGACGGCCGCGAACCCGGCCTGCGAGCCGCAGAGCCCCTCGCGCGCCTCGGCCGAGGATGCCGGTTCC
CACAGCGACCCACGGCCTATCCACCTGCTGCGGGCCCCCAGCTTCGACCCGCCGGCCTTTACGGCCGACGTCGCC
CCACCGCCCGCCATCTTCGTCGAGGAGCCACCCGTTGTGACGCCGCCTCCGCAATACGACACGGTCGTCGGCACG
CCCAGCGTCGACGGTCTGGCCGACTATTTCTCGCGTCTCGCCGACTATGGGCTCCGCAACGGAGAGGACTCAGGC
TCCGACTCGGACGAGACGCCGTCGCGGATCTTGGACCGGTCGGGACGGGTCAATGTGTCTCATCCGAGGACGCCC
GGGCGCCGCATGCCCAGCAGGAGCATGGAGATTGCTCGCCCTCCGCTGAGACTGAACCTCGACAGCCTGCCGGAT
CGATCTCGCGCTTCGGTCACTCCCGCCGCTTCGGGCGCGGCGGCGTAG
Transcript >Hirsu2|10051
ATGTCAGCGCCGCCACGACAGGGTCGTTCCCGCAACGGTAATTGGATCATCTCCAACGGCGGAAACGTCTTCTAC
CGCGTCGATACCCTCGCCCGGGACGCCGCCGCGCCTCCAGCACAGCAGCCGTCTCCGAGCTTGCCGGCGCCCCTC
ATCGGGCCTCGGCGTACGCGGCCGCACGCAATCCACATCATCACCTATCCGCCCGGCTACGTCCCGCGCGAGCTG
CGTCCGAAACCCCCCAGCAGATCCAGCAAGGCCGCCCAGTCACTCAGGGCCCGCTCCAAGATTGCCGCCAAGCTC
GGCCGCCCCGACGACAACGGCTGCGAGACGCCGAGCGGCAAGAGGAGGAGCCATCTACAGCAGTCACCGGTCTTG
GGCAAGCTGTTCGCCTCCTTCACCTCGAGCGCCTCGCGCGCCATCTCGTCGTCGTCTTCGTCCTCATCAGCCTCC
CCCTCGCCTCTGTCGTCCGCCGTCGCGTCGACACCGCCCTCGGACGAGTCGAGACCGCAATCCAGCCCAACGGCG
GGCCCCGCGGGGACAGGGATCAGGATCCCACGCCAAGCGGCAGCCTATGACGAAGTAGGCTCTACCGATCCCGCC
AACATCGACGCCCAGAGCCCACGAATCGACGAGCGCCGCCGTCAGCGTCACCGCCTGAGCCTTCCACTGCCGCAG
GCCCTGTCGGCTCTGCGCCGACGAGACGACGCCTCGAGCGGGACCCCAAGCGGGACCCCCGGCGGCACCGCGGCT
GCGCCCACGCTCAGGTCGCTGACAACCGACCGCGTCCTCGCCGCCTCGCCCTCGCCCTTCCCCGCATCTTCTCCC
ATCGCCGGCAGAGTCACGCCGACGACGAGGGCGTCGACCCCCACGACCACCACGAGAGCCACCAACACCCCGACG
CGCACCGCCATGGCCGCCATCGCCACCCCGGCGGCCTACCATCTCGGCGGTGCTGGTGGCAGCGCCGGTGCTATC
GGGGTCGGCGCTGGCAGCAGCGGCGGCAGCAACCGCAATAGCATCATGTCTATCCGCTCCGCCAAGTCGACCGTC
AGCTCCCTCGTCGCCGAGGTGCCGAAACCCGTTGCCTCCGGCAGCGGCGTCTCCTGCTCCATCCTTCTGGCCGAG
CCAAACGTCTTCCTCACCGGCTTTGACCACGAGCATGATCTGCAGCGCGAGGGCCACAGCGGCGGCACTGCCCTC
CTGCGCGGCAAGCTGCACCTCTCCATCAGCAAAAACGTAAAGATCAAGGCCGTTCAGCTCAAGCTACTCGGCCGC
GCCCGCACCGAGTGGCCTGAGGGCATCCCTCCGCTCAAGCAGGACATGGTCGAGGAGGAGAGTCTGCGGACTCAG
GTCCTGACCTTCTTCAACGCCATGAACGATGGCTGGGAGACCGAGTACGGCAATCAGTGCACGTACCAGCTCCGC
GCCGCCTCGGCCAATTCCTCCTCCACCAACCTGGCCGCTCTGCCTCGCGTCACCGGCCTCGCCCCCGCCTCCGCC
GCGAACCGCGGCGGTCTCACCGCCAAAGAGCTCAAGCGCCTCTCCCTCCAAAGCGTCCAGTCGCGCAGTTTCGGC
AAAGGCGAGAGCGGCGTCACCGCCCCGACCCAGGCCAAGGGTTTCAAGGTCTTCTACCCGGGCACGTACGACTAC
TCCTTCGAGCTCCCCATCGACCACCACCAGCTCGAGACGACCAAGCTGCAGTACGGCTCCGTCCGCTGGGAGCTG
CACGCCACCGTCGACCGCGCCGGCGCATTCAAGCCCAACCTACACGGCATGAAGGAGGTTCCCATCGTCCGCCTG
CCCGACCAGATGTCTCTCGAGACCACCGAGCCAATCTCCATCAGCCGCCAGTGGGAGGATCAGCTGCACTACGAC
ATCGTCATTTCCGGCAAGAGCTTCTCCATCGGTTCCAAGATACCCATCGCCTTTAAGCTCACCCCATTAGCCAAG
GTTCAGGTCCACAAGCTTAAAGTCTACGTCACCGAGACCATTGAATATTGGACGAACGACCGCCGCGTTACGCGC
AAAGAACCGGGCCGTAAGATCCTGCTGCTCGAGAAGTCGGCCGGCAAGCCGCTCGACGCCAATTGGGCCTCGTCC
GACATCACCACCGTCCGGGGTGGCGAGCCCACCACCGAGGCTCGCCGCGACGCCCGCGAGCTGGCCCAACGAAGG
CGCAATGCCGAGGCGGCCCGCGCCCACCGTTCGCCCGAGCCCCTACCCGAGCCTGCGGCCAACCTACTCGGTGAT
CTCGACCTCGGCCTCGAGAGCATGTGGGGCTCGACCGAGATCGAGGCTAACGTCCAGATCCCGACATGCGAGATG
ATGGCCAAGAACAAGGAGCTGAGACTGCATCCGGACTGCAGCTGGAAGAATGTCAATGTCTATCACTGGATCAAG
ATCGTCATGCGCATCAGCCGCATAGACCCCGAGGACCCGTCGGGCACGAAACGGCGACACTTTGAAATCAGCATC
GACTCTCCCTTCACCGTCCTCAACTGCCGGGCGACGCAGGCCAACACCAATCTGCCTGCCTACTCGGGTCCCATC
TGCCACCCCGCGCCCTTCCAGGCGGCCTGCGGCTGCCCGGACGCGGCCACGGTGGCCACCAACATTTCGCCCAGC
TCGTCGACCGGCACGCTGCTGGCGGTCGAGATGGTCAACGACATGCTCCCGACGCCTCCGCAGGCGGCGTACCTC
ACGAGCCCGACGGCCGCGAACCCGGCCTGCGAGCCGCAGAGCCCCTCGCGCGCCTCGGCCGAGGATGCCGGTTCC
CACAGCGACCCACGGCCTATCCACCTGCTGCGGGCCCCCAGCTTCGACCCGCCGGCCTTTACGGCCGACGTCGCC
CCACCGCCCGCCATCTTCGTCGAGGAGCCACCCGTTGTGACGCCGCCTCCGCAATACGACACGGTCGTCGGCACG
CCCAGCGTCGACGGTCTGGCCGACTATTTCTCGCGTCTCGCCGACTATGGGCTCCGCAACGGAGAGGACTCAGGC
TCCGACTCGGACGAGACGCCGTCGCGGATCTTGGACCGGTCGGGACGGGTCAATGTGTCTCATCCGAGGACGCCC
GGGCGCCGCATGCCCAGCAGGAGCATGGAGATTGCTCGCCCTCCGCTGAGACTGAACCTCGACAGCCTGCCGGAT
CGATCTCGCGCTTCGGTCACTCCCGCCGCTTCGGGCGCGGCGGCGTAG
Gene >Hirsu2|10051
ATGTCAGCGCCGCCACGACAGGGTCGTTCCCGCAACGGTAATTGGATCATCTCCAACGGCGGAAACGTCTTCTAC
CGCGTCGATACCCTCGCCCGGGACGCCGCCGCGCCTCCAGCACAGCAGCCGTCTCCGAGCTTGCCGGCGCCCCTC
ATCGGGCCTCGGCGTACGCGGCCGCACGCAATCCACATCATCACCTATCCGCCCGGCTACGTCCCGCGCGAGCTG
CGTCCGAAACCCCCCAGCAGATCCAGCAAGGCCGCCCAGTCACTCAGGGCCCGCTCCAAGATTGCCGCCAAGCTC
GGCCGCCCCGACGACAACGGCTGCGAGACGCCGAGCGGCAAGAGGAGGAGCCATCTACAGCAGTCACCGGTCTTG
GGCAAGCTGTTCGCCTCCTTCACCTCGAGCGCCTCGCGCGCCATCTCGTCGTCGTCTTCGTCCTCATCAGCCTCC
CCCTCGCCTCTGTCGTCCGCCGTCGCGTCGACACCGCCCTCGGACGAGTCGAGACCGCAATCCAGCCCAACGGCG
GGCCCCGCGGGGACAGGGATCAGGATCCCACGCCAAGCGGCAGCCTATGACGAAGTAGGCTCTACCGATCCCGCC
AACATCGACGCCCAGAGCCCACGAATCGACGAGCGCCGCCGTCAGCGTCACCGCCTGAGCCTTCCACTGCCGCAG
GCCCTGTCGGCTCTGCGCCGACGAGACGACGCCTCGAGCGGGACCCCAAGCGGGACCCCCGGCGGCACCGCGGCT
GCGCCCACGCTCAGGTCGCTGACAACCGACCGCGTCCTCGCCGCCTCGCCCTCGCCCTTCCCCGCATCTTCTCCC
ATCGCCGGCAGAGTCACGCCGACGACGAGGGCGTCGACCCCCACGACCACCACGAGAGCCACCAACACCCCGACG
CGCACCGCCATGGCCGCCATCGCCACCCCGGCGGCCTACCATCTCGGCGGTGCTGGTGGCAGCGCCGGTGCTATC
GGGGTCGGCGCTGGCAGCAGCGGCGGCAGCAACCGCAATAGCATCATGTCTATCCGCTCCGCCAAGTCGACCGTC
AGCTCCCTCGTCGCCGAGGTGCCGAAACCCGTTGCCTCCGGCAGCGGCGTCTCCTGCTCCATCCTTCTGGCCGAG
CCAAACGTCTTCCTCACCGGCTTTGACCACGAGCATGATCTGCAGCGCGAGGGCCACAGCGGCGGCACTGCCCTC
CTGCGCGGCAAGCTGCACCTCTCCATCAGCAAAAACGTAAAGATCAAGGCCGTTCAGCTCAAGCTACTCGGCCGC
GCCCGCACCGAGTGGCCTGAGGGCATCCCTCCGCTCAAGCAGGACATGGTCGAGGAGGAGAGTCTGCGGACTCAG
GTCCTGACCTTCTTCAACGCCATGAACGATGGCTGGGAGACCGAGTACGGCAATCAGTGCACGTACCAGCTCCGC
GCCGCCTCGGCCAATTCCTCCTCCACCAACCTGGCCGCTCTGCCTCGCGTCACCGGCCTCGCCCCCGCCTCCGCC
GCGAACCGCGGCGGTCTCACCGCCAAAGAGCTCAAGCGCCTCTCCCTCCAAAGCGTCCAGTCGCGCAGTTTCGGC
AAAGGCGAGAGCGGCGTCACCGCCCCGACCCAGGCCAAGGGTTTCAAGGTCTTCTACCCGGGCACGTACGACTAC
TCCTTCGAGCTCCCCATCGACCACCACCAGCTCGAGACGACCAAGCTGCAGTACGGCTCCGTCCGCTGGGAGCTG
CACGCCACCGTCGACCGCGCCGGCGCATTCAAGCCCAACCTACACGGCATGAAGGAGGTTCCCATCGTCCGCCTG
CCCGACCAGATGTCTCTCGAGACCACCGAGCCAATCTCCATCAGCCGCCAGTGGGAGGATCAGCTGCACTACGAC
ATCGTCATTTCCGGCAAGAGCTTCTCCATCGGTTCCAAGATACCCATCGCCTTTAAGCTCACCCCATTAGCCAAG
GTTCAGGTCCACAAGCTTAAAGTCTACGTCACCGAGACCATTGAATATTGGACGAACGACCGCCGCGTTACGCGC
AAAGAACCGGGCCGTAAGATCCTGCTGCTCGAGAAGTCGGCCGGCAAGCCGCTCGACGCCAATTGGGCCTCGTCC
GACATCACCACCGTCCGGGGTGGCGAGCCCACCACCGAGGCTCGCCGCGACGCCCGCGAGCTGGCCCAACGAAGG
CGCAATGCCGAGGCGGCCCGCGCCCACCGTTCGCCCGAGCCCCTACCCGAGCCTGCGGCCAACCTACTCGGTGAT
CTCGACCTCGGCCTCGAGAGCATGTGGGGCTCGACCGAGATCGAGGCTAACGTCCAGATCCCGACATGCGAGATG
ATGGCCAAGAACAAGGAGCTGAGACTGCATCCGGACTGCAGCTGGAAGAATGTCAATGTCTATCACTGGATCAAG
GTTCGTTGCTGCGATTGCCCCTTCCCCTCCCGCTGCCCCTTGTCTGTTTGTCCTAGCTAATCATTTTTCTGCTCG
TACACAGATCGTCATGCGCATCAGCCGCATAGACCCCGAGGACCCGTCGGGCACGAAACGGCGACACTTTGAAAT
CAGCATCGACTCTCCCTTCACCGTCCTCAACTGCCGGGCGACGCAGGCCAACACCAATCTGCCTGCCTACTCGGG
TCCCATCTGCCACCCCGCGCCCTTCCAGGCGGCCTGCGGCTGCCCGGACGCGGCCACGGTGGCCACCAACATTTC
GCCCAGCTCGTCGACCGGCACGCTGCTGGCGGTCGAGATGGTCAACGACATGCTCCCGACGCCTCCGCAGGCGGC
GTACCTCACGAGCCCGACGGCCGCGAACCCGGCCTGCGAGCCGCAGAGCCCCTCGCGCGCCTCGGCCGAGGATGC
CGGTTCCCACAGCGACCCACGGCCTATCCACCTGCTGCGGGCCCCCAGCTTCGACCCGCCGGCCTTTACGGCCGA
CGTCGCCCCACCGCCCGCCATCTTCGTCGAGGAGCCACCCGTTGTGACGCCGCCTCCGCAATACGACACGGTCGT
CGGCACGCCCAGCGTCGACGGTCTGGCCGACTATTTCTCGCGTCTCGCCGACTATGGGCTCCGCAACGGAGAGGA
CTCAGGCTCCGACTCGGACGAGACGCCGTCGCGGATCTTGGACCGGTCGGGACGGGTCAATGTGTCTCATCCGAG
GACGCCCGGGCGCCGCATGCCCAGCAGGAGCATGGAGATTGCTCGCCCTCCGCTGAGACTGAACCTCGACAGCCT
GCCGGATCGATCTCGCGCTTCGGTCACTCCCGCCGCTTCGGGCGCGGCGGCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail