Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10046
Gene name
LocationContig_78:19791..23528
Strand+
Gene length (bp)3737
Transcript length (bp)3420
Coding sequence length (bp)3420
Protein length (aa) 1140

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04082 Fungal_trans Fungal specific transcription factor domain 1.2E-16 509 850
PF00096 zf-C2H2 Zinc finger, C2H2 type 3.2E-03 47 69
PF00096 zf-C2H2 Zinc finger, C2H2 type 1.2E-03 75 98

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P46974|RSF2_YEAST Respiration factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSF2 PE=1 SV=1 40 135 3.0E-23
sp|Q04545|TDA9_YEAST Probable transcription factor TDA9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TDA9 PE=1 SV=1 4 98 1.0E-21
sp|Q5AF56|ADR1_CANAL Transcriptional regulator ADR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADR1 PE=2 SV=1 34 113 2.0E-21
sp|P78871|RST2_SCHPO Zinc finger protein rst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rst2 PE=2 SV=2 8 103 7.0E-20
sp|P07248|ADR1_YEAST Regulatory protein ADR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADR1 PE=1 SV=2 43 137 4.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P46974|RSF2_YEAST Respiration factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSF2 PE=1 SV=1 40 135 3.0E-23
sp|Q04545|TDA9_YEAST Probable transcription factor TDA9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TDA9 PE=1 SV=1 4 98 1.0E-21
sp|Q5AF56|ADR1_CANAL Transcriptional regulator ADR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADR1 PE=2 SV=1 34 113 2.0E-21
sp|P78871|RST2_SCHPO Zinc finger protein rst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rst2 PE=2 SV=2 8 103 7.0E-20
sp|P07248|ADR1_YEAST Regulatory protein ADR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADR1 PE=1 SV=2 43 137 4.0E-18
sp|Q5A4K7|TRY5_CANAL Transcriptional regulator of yeast form adherence 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TRY5 PE=3 SV=1 45 110 1.0E-15
sp|Q9ERU3|ZNF22_MOUSE Zinc finger protein 22 OS=Mus musculus GN=Znf22 PE=1 SV=2 45 131 3.0E-12
sp|P27705|MIG1_YEAST Regulatory protein MIG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIG1 PE=1 SV=1 40 116 5.0E-12
sp|P18738|ZG9_XENLA Gastrula zinc finger protein XlCGF9.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 45 94 6.0E-12
sp|P18731|ZG62_XENLA Gastrula zinc finger protein XlCGF62.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 43 103 8.0E-12
sp|Q9ERU2|ZNF22_RAT Zinc finger protein 22 OS=Rattus norvegicus GN=Znf22 PE=2 SV=2 45 131 2.0E-11
sp|P53243|YG2A_YEAST Zinc finger protein YGR067C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGR067C PE=3 SV=2 45 105 5.0E-11
sp|P18718|ZG3_XENLA Gastrula zinc finger protein xLCGF3.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 45 94 5.0E-11
sp|Q5AMH6|CAS5_CANAL Cell wall integrity transcriptional regulator CAS5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAS5 PE=3 SV=1 40 98 6.0E-11
sp|Q05620|CREA_ASPNG DNA-binding protein creA OS=Aspergillus niger GN=creA PE=3 SV=1 40 110 8.0E-11
sp|A1DH89|CREA_NEOFI Probable DNA-binding protein creA OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=creA PE=3 SV=1 5 110 9.0E-11
sp|B0XSK6|CREA_ASPFC Probable DNA-binding protein creA OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=creA PE=3 SV=1 39 110 1.0E-10
sp|Q1LZC0|ZNF22_BOVIN Zinc finger protein 22 OS=Bos taurus GN=ZNF22 PE=2 SV=1 45 131 1.0E-10
sp|Q4X0Z3|CREA_ASPFU Probable DNA-binding protein creA OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=creA PE=3 SV=1 39 110 1.0E-10
sp|P50898|MIG1_KLULA Regulatory protein MIG1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MIG1 PE=3 SV=1 42 95 1.0E-10
sp|Q5ANC8|TRY4_CANAL Transcriptional regulator of yeast form adherence 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TRY4 PE=2 SV=1 49 101 2.0E-10
sp|Q01981|CREA_EMENI DNA-binding protein creA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=creA PE=1 SV=1 40 110 2.0E-10
sp|P18735|ZG7_XENLA Gastrula zinc finger protein XlCGF7.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 45 103 2.0E-10
sp|Q5AF56|ADR1_CANAL Transcriptional regulator ADR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADR1 PE=2 SV=1 497 719 3.0E-10
sp|O94130|CREA_BOTFU DNA-binding protein creA OS=Botryotinia fuckeliana GN=creA PE=3 SV=1 40 114 4.0E-10
sp|Q9HFS2|CREA_COCCA DNA-binding protein creA OS=Cochliobolus carbonum GN=CREA PE=2 SV=1 39 106 5.0E-10
sp|Q96N77|ZN641_HUMAN Zinc finger protein 641 OS=Homo sapiens GN=ZNF641 PE=1 SV=2 7 111 5.0E-10
sp|O14335|SCR1_SCHPO DNA-binding protein scr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=scr1 PE=3 SV=1 42 93 6.0E-10
sp|O94166|CREA_ASPAC DNA-binding protein creA OS=Aspergillus aculeatus GN=creA PE=3 SV=1 40 110 6.0E-10
sp|Q9P889|CREA_ASPOR DNA-binding protein creA OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=creA PE=3 SV=1 40 110 6.0E-10
sp|B8NGC8|CREA_ASPFN Probable DNA-binding protein creA OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=creA PE=3 SV=1 40 110 6.0E-10
sp|B5DE03|WT1_XENTR Wilms tumor protein homolog OS=Xenopus tropicalis GN=wt1 PE=2 SV=1 45 99 7.0E-10
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 45 99 7.0E-10
sp|Q9Y7G2|MIG1_CANAX Regulatory protein MIG1 OS=Candida albicans GN=MIG1 PE=3 SV=1 26 112 7.0E-10
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 29 93 9.0E-10
sp|Q59U10|BCR1_CANAL Biofilm and cell wall regulator 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BCR1 PE=1 SV=1 52 98 9.0E-10
sp|P18750|ZO61_XENLA Oocyte zinc finger protein XlCOF6.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 45 103 1.0E-09
sp|P18713|ZG17_XENLA Gastrula zinc finger protein XlCGF17.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 45 105 1.0E-09
sp|O59958|CRE1_NEUCR DNA-binding protein cre-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cre-1 PE=2 SV=2 39 110 1.0E-09
sp|Q68DI1|ZN776_HUMAN Zinc finger protein 776 OS=Homo sapiens GN=ZNF776 PE=1 SV=2 45 153 1.0E-09
sp|Q5R4X5|ZNF22_PONAB Zinc finger protein 22 OS=Pongo abelii GN=ZNF22 PE=2 SV=1 45 111 1.0E-09
sp|P17026|ZNF22_HUMAN Zinc finger protein 22 OS=Homo sapiens GN=ZNF22 PE=1 SV=3 45 111 1.0E-09
sp|P33749|MSN4_YEAST Zinc finger protein MSN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSN4 PE=1 SV=1 31 93 1.0E-09
sp|P18736|ZG71_XENLA Gastrula zinc finger protein XlCGF71.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 45 94 1.0E-09
sp|P18750|ZO61_XENLA Oocyte zinc finger protein XlCOF6.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 45 93 2.0E-09
sp|P18713|ZG17_XENLA Gastrula zinc finger protein XlCGF17.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 45 102 2.0E-09
sp|P49953|WT1_SMIMA Wilms tumor protein homolog (Fragment) OS=Sminthopsis macroura GN=WT1 PE=2 SV=1 45 99 2.0E-09
sp|P53035|MIG2_YEAST Regulatory protein MIG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIG2 PE=1 SV=1 39 93 2.0E-09
sp|Q9P7D9|RSV1_SCHPO Zinc finger protein rsv1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsv1 PE=2 SV=1 49 93 2.0E-09
sp|Q12132|USV1_YEAST Nutrient and stress factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=USV1 PE=1 SV=1 52 98 2.0E-09
sp|Q6NZQ6|ZN740_MOUSE Zinc finger protein 740 OS=Mus musculus GN=Znf740 PE=1 SV=1 45 105 3.0E-09
sp|O74252|STE12_EMENI Transcription factor steA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=steA PE=2 SV=1 47 99 3.0E-09
sp|Q9UDV7|ZN282_HUMAN Zinc finger protein 282 OS=Homo sapiens GN=ZNF282 PE=2 SV=3 45 105 3.0E-09
sp|P18736|ZG71_XENLA Gastrula zinc finger protein XlCGF71.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 45 94 5.0E-09
sp|P52288|MIG1_KLUMA Regulatory protein MIG1 OS=Kluyveromyces marxianus GN=MIG1 PE=3 SV=1 42 100 5.0E-09
sp|O94131|CREA_GIBFU DNA-binding protein creA OS=Gibberella fujikuroi GN=CREA PE=3 SV=1 44 110 5.0E-09
sp|Q8TD17|ZN398_HUMAN Zinc finger protein 398 OS=Homo sapiens GN=ZNF398 PE=1 SV=1 45 103 5.0E-09
sp|Q8NDX6|ZN740_HUMAN Zinc finger protein 740 OS=Homo sapiens GN=ZNF740 PE=1 SV=1 45 105 6.0E-09
sp|P18732|ZG64_XENLA Gastrula zinc finger protein XlCGF64.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 45 94 6.0E-09
sp|Q02446|SP4_HUMAN Transcription factor Sp4 OS=Homo sapiens GN=SP4 PE=1 SV=2 45 99 6.0E-09
sp|Q62445|SP4_MOUSE Transcription factor Sp4 OS=Mus musculus GN=Sp4 PE=2 SV=2 45 99 7.0E-09
sp|Q8SUR9|Z856_ENCCU Zinc finger C2H2 protein ECU08_0560 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU08_0560 PE=3 SV=2 43 101 7.0E-09
sp|P18743|ZO2_XENLA Oocyte zinc finger protein XlCOF2 (Fragment) OS=Xenopus laevis PE=3 SV=1 45 98 8.0E-09
sp|Q8BZ34|ZN641_MOUSE Zinc finger protein 641 OS=Mus musculus GN=Znf641 PE=2 SV=1 44 105 8.0E-09
sp|P18722|ZG46_XENLA Gastrula zinc finger protein XlCGF46.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 15 103 9.0E-09
sp|Q96N77|ZN641_HUMAN Zinc finger protein 641 OS=Homo sapiens GN=ZNF641 PE=1 SV=2 44 93 1.0E-08
sp|Q59RR3|MNL1_CANAL Transcriptional regulator MNL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MNL1 PE=3 SV=1 41 99 1.0E-08
sp|P17036|ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens GN=ZNF3 PE=1 SV=3 20 103 1.0E-08
sp|Q9UTS5|ZAS1_SCHPO Zinc finger protein zas1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zas1 PE=2 SV=1 52 98 1.0E-08
sp|Q9GZX5|ZN350_HUMAN Zinc finger protein 350 OS=Homo sapiens GN=ZNF350 PE=1 SV=3 45 153 1.0E-08
sp|P43301|EGR3_RAT Early growth response protein 3 OS=Rattus norvegicus GN=Egr3 PE=2 SV=1 45 130 1.0E-08
sp|Q8BZ34|ZN641_MOUSE Zinc finger protein 641 OS=Mus musculus GN=Znf641 PE=2 SV=1 45 141 2.0E-08
sp|P43300|EGR3_MOUSE Early growth response protein 3 OS=Mus musculus GN=Egr3 PE=2 SV=2 45 130 2.0E-08
sp|O95125|ZN202_HUMAN Zinc finger protein 202 OS=Homo sapiens GN=ZNF202 PE=1 SV=4 45 95 2.0E-08
sp|O95125|ZN202_HUMAN Zinc finger protein 202 OS=Homo sapiens GN=ZNF202 PE=1 SV=4 45 111 2.0E-08
sp|Q96N20|ZN75A_HUMAN Zinc finger protein 75A OS=Homo sapiens GN=ZNF75A PE=2 SV=1 45 98 2.0E-08
sp|O57415|RREB1_CHICK Ras-responsive element-binding protein 1 OS=Gallus gallus GN=RREB1 PE=2 SV=2 40 138 2.0E-08
sp|Q90WR8|SP3_CHICK Transcription factor Sp3 OS=Gallus gallus GN=SP3 PE=1 SV=1 45 99 2.0E-08
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 45 103 2.0E-08
sp|Q02447|SP3_HUMAN Transcription factor Sp3 OS=Homo sapiens GN=SP3 PE=1 SV=3 45 99 2.0E-08
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 45 95 2.0E-08
sp|P19544|WT1_HUMAN Wilms tumor protein OS=Homo sapiens GN=WT1 PE=1 SV=2 45 99 2.0E-08
sp|Q3UH06|RREB1_MOUSE Ras-responsive element-binding protein 1 OS=Mus musculus GN=Rreb1 PE=1 SV=2 2 140 2.0E-08
sp|B7ZSG3|WT1A_XENLA Wilms tumor protein homolog A OS=Xenopus laevis GN=wt1-a PE=2 SV=1 45 99 2.0E-08
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 45 95 2.0E-08
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 45 95 2.0E-08
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 45 95 2.0E-08
sp|O62651|WT1_PIG Wilms tumor protein homolog OS=Sus scrofa GN=WT1 PE=2 SV=1 45 99 2.0E-08
sp|P39943|MIG3_YEAST Transcription corepressor MIG3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIG3 PE=1 SV=1 38 93 2.0E-08
sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens GN=ZNF771 PE=1 SV=1 29 93 2.0E-08
sp|P18734|ZG67_XENLA Gastrula zinc finger protein XlCGF67.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 40 105 2.0E-08
sp|P18750|ZO61_XENLA Oocyte zinc finger protein XlCOF6.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 13 94 3.0E-08
sp|A8MWA4|Z705E_HUMAN Putative zinc finger protein 705E OS=Homo sapiens GN=ZNF705E PE=3 SV=1 45 95 3.0E-08
sp|P11161|EGR2_HUMAN E3 SUMO-protein ligase EGR2 OS=Homo sapiens GN=EGR2 PE=1 SV=3 45 120 3.0E-08
sp|P18724|ZG49_XENLA Gastrula zinc finger protein XlCGF49.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 45 105 3.0E-08
sp|Q7Z7K2|ZN467_HUMAN Zinc finger protein 467 OS=Homo sapiens GN=ZNF467 PE=2 SV=1 45 104 3.0E-08
sp|Q9BUG6|ZSA5A_HUMAN Zinc finger and SCAN domain-containing protein 5A OS=Homo sapiens GN=ZSCAN5A PE=2 SV=1 45 103 3.0E-08
sp|Q0IHB8|OSR2B_XENLA Protein odd-skipped-related 2-B OS=Xenopus laevis GN=osr2-b PE=2 SV=1 45 104 3.0E-08
sp|O70494|SP3_MOUSE Transcription factor Sp3 OS=Mus musculus GN=Sp3 PE=1 SV=2 45 99 3.0E-08
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 45 95 3.0E-08
sp|P08047|SP1_HUMAN Transcription factor Sp1 OS=Homo sapiens GN=SP1 PE=1 SV=3 45 99 3.0E-08
sp|Q32NK7|OSR2A_XENLA Protein odd-skipped-related 2-A OS=Xenopus laevis GN=osr2-a PE=2 SV=1 45 104 3.0E-08
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 45 95 3.0E-08
sp|Q5R4X5|ZNF22_PONAB Zinc finger protein 22 OS=Pongo abelii GN=ZNF22 PE=2 SV=1 45 103 4.0E-08
sp|P17026|ZNF22_HUMAN Zinc finger protein 22 OS=Homo sapiens GN=ZNF22 PE=1 SV=3 45 103 4.0E-08
sp|O89090|SP1_MOUSE Transcription factor Sp1 OS=Mus musculus GN=Sp1 PE=1 SV=2 45 99 4.0E-08
sp|A8MVS1|Z705F_HUMAN Zinc finger protein 705F OS=Homo sapiens GN=ZNF705F PE=3 SV=1 45 95 4.0E-08
sp|Q01714|SP1_RAT Transcription factor Sp1 OS=Rattus norvegicus GN=Sp1 PE=1 SV=2 45 99 4.0E-08
sp|A4II20|EGR1_XENTR Early growth response protein 1 OS=Xenopus tropicalis GN=egr1 PE=2 SV=2 45 98 4.0E-08
sp|P0CH99|Z705D_HUMAN Zinc finger protein 705D OS=Homo sapiens GN=ZNF705D PE=2 SV=1 45 95 4.0E-08
sp|Q06889|EGR3_HUMAN Early growth response protein 3 OS=Homo sapiens GN=EGR3 PE=2 SV=1 45 130 4.0E-08
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 45 103 4.0E-08
sp|P0CI00|Z705B_HUMAN Putative zinc finger protein 705B OS=Homo sapiens GN=ZNF705B PE=5 SV=1 45 95 4.0E-08
sp|P08046|EGR1_MOUSE Early growth response protein 1 OS=Mus musculus GN=Egr1 PE=1 SV=2 45 98 4.0E-08
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 45 103 5.0E-08
sp|P18146|EGR1_HUMAN Early growth response protein 1 OS=Homo sapiens GN=EGR1 PE=1 SV=1 45 98 5.0E-08
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 45 99 5.0E-08
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 45 154 5.0E-08
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 45 154 5.0E-08
sp|Q6GQH4|EGR1A_XENLA Early growth response protein 1-A OS=Xenopus laevis GN=egr1-a PE=2 SV=1 45 98 5.0E-08
sp|Q96BV0|ZN775_HUMAN Zinc finger protein 775 OS=Homo sapiens GN=ZNF775 PE=2 SV=2 45 95 5.0E-08
sp|P50902|WT1_ALLMI Wilms tumor protein homolog (Fragment) OS=Alligator mississippiensis GN=WT1 PE=2 SV=1 45 99 5.0E-08
sp|P18742|ZO19_XENLA Oocyte zinc finger protein XlCOF19 (Fragment) OS=Xenopus laevis PE=3 SV=1 45 103 5.0E-08
sp|P17030|ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens GN=ZNF25 PE=2 SV=2 12 95 5.0E-08
sp|Q8N0Y2|ZN444_HUMAN Zinc finger protein 444 OS=Homo sapiens GN=ZNF444 PE=1 SV=1 29 95 5.0E-08
sp|P39956|RPH1_YEAST DNA damage-responsive transcriptional repressor RPH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPH1 PE=1 SV=1 43 96 5.0E-08
sp|A6NDX5|ZN840_HUMAN Putative zinc finger protein 840 OS=Homo sapiens GN=ZNF840P PE=5 SV=5 45 95 5.0E-08
sp|P08154|EGR1_RAT Early growth response protein 1 OS=Rattus norvegicus GN=Egr1 PE=1 SV=2 45 98 5.0E-08
sp|Q4VBD9|GZF1_MOUSE GDNF-inducible zinc finger protein 1 OS=Mus musculus GN=Gzf1 PE=1 SV=2 13 103 5.0E-08
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 45 103 6.0E-08
sp|Q9H116|GZF1_HUMAN GDNF-inducible zinc finger protein 1 OS=Homo sapiens GN=GZF1 PE=1 SV=1 12 103 6.0E-08
sp|Q6ZN79|Z705A_HUMAN Zinc finger protein 705A OS=Homo sapiens GN=ZNF705A PE=2 SV=1 45 95 6.0E-08
sp|Q5RF70|ZN501_PONAB Zinc finger protein 501 OS=Pongo abelii GN=ZNF501 PE=2 SV=3 45 103 6.0E-08
sp|P26632|EGR1_DANRE Early growth response protein 1 OS=Danio rerio GN=egr1 PE=2 SV=2 45 98 6.0E-08
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 45 95 6.0E-08
sp|Q00453|RGM1_YEAST Probable transcription repressor protein RGM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGM1 PE=1 SV=2 52 98 6.0E-08
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 45 98 6.0E-08
sp|P18712|ZG16_XENLA Gastrula zinc finger protein XlCGF16.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 46 102 6.0E-08
sp|Q92766|RREB1_HUMAN Ras-responsive element-binding protein 1 OS=Homo sapiens GN=RREB1 PE=1 SV=3 39 99 7.0E-08
sp|Q4R6J4|ZN684_MACFA Zinc finger protein 684 OS=Macaca fascicularis GN=ZNF684 PE=2 SV=1 49 103 7.0E-08
sp|D3ZUU2|GZF1_RAT GDNF-inducible zinc finger protein 1 OS=Rattus norvegicus GN=Gzf1 PE=1 SV=1 13 103 7.0E-08
sp|Q10076|HSR1_SCHPO Hydrogen peroxide stress regulator 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hsr1 PE=2 SV=1 48 103 7.0E-08
sp|Q8WTR7|ZN473_HUMAN Zinc finger protein 473 OS=Homo sapiens GN=ZNF473 PE=1 SV=1 45 103 7.0E-08
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 45 103 7.0E-08
sp|Q5RJR4|ZN467_RAT Zinc finger protein 467 OS=Rattus norvegicus GN=Znf467 PE=2 SV=1 45 105 7.0E-08
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 45 107 7.0E-08
sp|Q4VA44|ZN664_MOUSE Zinc finger protein 664 OS=Mus musculus GN=Znf664 PE=2 SV=2 45 103 7.0E-08
sp|Q8N3J9|ZN664_HUMAN Zinc finger protein 664 OS=Homo sapiens GN=ZNF664 PE=2 SV=1 45 103 7.0E-08
sp|O73693|EGR1_TAEGU Early growth response protein 1 (Fragment) OS=Taeniopygia guttata GN=EGR1 PE=3 SV=1 45 98 7.0E-08
sp|Q6NTY6|EGR1B_XENLA Early growth response protein 1-B OS=Xenopus laevis GN=egr1-b PE=2 SV=1 45 98 7.0E-08
sp|Q60493|ZN664_CAVPO Zinc finger protein 664 OS=Cavia porcellus GN=ZNF664 PE=2 SV=1 45 103 8.0E-08
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 45 95 8.0E-08
sp|Q9ULD5|ZN777_HUMAN Zinc finger protein 777 OS=Homo sapiens GN=ZNF777 PE=1 SV=2 48 106 8.0E-08
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 43 112 8.0E-08
sp|A1XSY8|EGR2_PIG E3 SUMO-protein ligase EGR2 OS=Sus scrofa GN=EGR2 PE=2 SV=1 45 98 8.0E-08
sp|P49953|WT1_SMIMA Wilms tumor protein homolog (Fragment) OS=Sminthopsis macroura GN=WT1 PE=2 SV=1 40 96 9.0E-08
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 45 95 9.0E-08
sp|P18738|ZG9_XENLA Gastrula zinc finger protein XlCGF9.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 45 107 1.0E-07
sp|P18731|ZG62_XENLA Gastrula zinc finger protein XlCGF62.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 45 103 1.0E-07
sp|P18736|ZG71_XENLA Gastrula zinc finger protein XlCGF71.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 49 105 1.0E-07
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 45 93 1.0E-07
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 12 103 1.0E-07
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 45 93 1.0E-07
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 12 103 1.0E-07
sp|P18734|ZG67_XENLA Gastrula zinc finger protein XlCGF67.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 45 105 1.0E-07
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 45 103 1.0E-07
sp|Q9BYN7|ZN341_HUMAN Zinc finger protein 341 OS=Homo sapiens GN=ZNF341 PE=1 SV=2 2 95 1.0E-07
sp|P14404|EVI1_MOUSE MDS1 and EVI1 complex locus protein EVI1 OS=Mus musculus GN=Mecom PE=1 SV=1 45 159 1.0E-07
sp|Q5T5D7|ZN684_HUMAN Zinc finger protein 684 OS=Homo sapiens GN=ZNF684 PE=2 SV=1 49 103 1.0E-07
sp|Q8JZL0|ZN467_MOUSE Zinc finger protein 467 OS=Mus musculus GN=Znf467 PE=1 SV=1 45 95 1.0E-07
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 45 103 1.0E-07
sp|Q24266|BTD_DROME Transcription factor btd OS=Drosophila melanogaster GN=btd PE=2 SV=1 45 95 1.0E-07
sp|Q3MJ62|ZSC23_HUMAN Zinc finger and SCAN domain-containing protein 23 OS=Homo sapiens GN=ZSCAN23 PE=2 SV=1 45 98 1.0E-07
sp|P18746|ZO26_XENLA Oocyte zinc finger protein XlCOF26 (Fragment) OS=Xenopus laevis PE=3 SV=1 45 95 1.0E-07
sp|O73692|EGR1_COTJA Early growth response protein 1 (Fragment) OS=Coturnix coturnix japonica GN=EGR1 PE=3 SV=1 45 98 1.0E-07
sp|Q61624|ZN148_MOUSE Zinc finger protein 148 OS=Mus musculus GN=Znf148 PE=1 SV=2 23 103 1.0E-07
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 45 107 1.0E-07
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 45 95 1.0E-07
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 45 93 1.0E-07
sp|Q3Y4E1|ZN148_BOVIN Zinc finger protein 148 OS=Bos taurus GN=ZNF148 PE=2 SV=1 23 103 1.0E-07
sp|Q9UQR1|ZN148_HUMAN Zinc finger protein 148 OS=Homo sapiens GN=ZNF148 PE=1 SV=2 23 103 1.0E-07
sp|Q62806|ZN148_RAT Zinc finger protein 148 OS=Rattus norvegicus GN=Znf148 PE=1 SV=1 23 103 1.0E-07
sp|Q5R782|ZN148_PONAB Zinc finger protein 148 OS=Pongo abelii GN=ZNF148 PE=2 SV=1 23 103 1.0E-07
sp|O73691|EGR1_CHICK Early growth response protein 1 (Fragment) OS=Gallus gallus GN=EGR1 PE=3 SV=1 45 98 1.0E-07
sp|P08152|EGR2_MOUSE E3 SUMO-protein ligase EGR2 OS=Mus musculus GN=Egr2 PE=1 SV=3 45 98 1.0E-07
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 45 154 1.0E-07
sp|P18738|ZG9_XENLA Gastrula zinc finger protein XlCGF9.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 45 93 2.0E-07
sp|Q1LZC0|ZNF22_BOVIN Zinc finger protein 22 OS=Bos taurus GN=ZNF22 PE=2 SV=1 45 103 2.0E-07
sp|P18722|ZG46_XENLA Gastrula zinc finger protein XlCGF46.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 49 94 2.0E-07
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 45 103 2.0E-07
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 45 103 2.0E-07
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 45 93 2.0E-07
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 12 103 2.0E-07
sp|P18724|ZG49_XENLA Gastrula zinc finger protein XlCGF49.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 12 103 2.0E-07
sp|Q7Z7K2|ZN467_HUMAN Zinc finger protein 467 OS=Homo sapiens GN=ZNF467 PE=2 SV=1 45 94 2.0E-07
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 46 94 2.0E-07
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 46 94 2.0E-07
sp|Q4R6J4|ZN684_MACFA Zinc finger protein 684 OS=Macaca fascicularis GN=ZNF684 PE=2 SV=1 45 98 2.0E-07
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 45 103 2.0E-07
sp|Q5T5D7|ZN684_HUMAN Zinc finger protein 684 OS=Homo sapiens GN=ZNF684 PE=2 SV=1 45 98 2.0E-07
sp|P51774|EGR2_RAT E3 SUMO-protein ligase EGR2 OS=Rattus norvegicus GN=Egr2 PE=2 SV=2 45 98 2.0E-07
sp|A6NGD5|ZSA5C_HUMAN Putative zinc finger and SCAN domain-containing protein 5C OS=Homo sapiens GN=ZSCAN5CP PE=5 SV=1 45 103 2.0E-07
sp|P08042|ZFP1_MOUSE Zinc finger protein 1 OS=Mus musculus GN=Zfp1 PE=2 SV=3 45 153 2.0E-07
sp|Q16670|ZSC26_HUMAN Zinc finger and SCAN domain-containing protein 26 OS=Homo sapiens GN=ZSCAN26 PE=1 SV=2 12 154 2.0E-07
sp|Q15973|ZN124_HUMAN Zinc finger protein 124 OS=Homo sapiens GN=ZNF124 PE=1 SV=2 45 103 2.0E-07
sp|Q03833|GIS1_YEAST Transcriptional activator/repressor GIS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS1 PE=1 SV=1 41 96 2.0E-07
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 44 95 2.0E-07
sp|Q6GQR8|ZN329_MOUSE Zinc finger protein 329 OS=Mus musculus GN=Znf329 PE=1 SV=2 14 153 2.0E-07
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 14 153 2.0E-07
sp|Q5RAM9|ZN664_PONAB Zinc finger protein 664 OS=Pongo abelii GN=ZNF664 PE=2 SV=1 45 95 2.0E-07
sp|P52744|ZN138_HUMAN Zinc finger protein 138 OS=Homo sapiens GN=ZNF138 PE=1 SV=2 45 94 2.0E-07
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 45 95 2.0E-07
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 45 93 2.0E-07
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 45 103 2.0E-07
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 45 107 2.0E-07
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 45 154 2.0E-07
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 12 103 2.0E-07
sp|P52738|ZN140_HUMAN Zinc finger protein 140 OS=Homo sapiens GN=ZNF140 PE=2 SV=2 44 95 2.0E-07
sp|P10074|ZBT48_HUMAN Zinc finger and BTB domain-containing protein 48 OS=Homo sapiens GN=ZBTB48 PE=1 SV=2 46 96 2.0E-07
sp|Q8TDD2|SP7_HUMAN Transcription factor Sp7 OS=Homo sapiens GN=SP7 PE=1 SV=1 45 151 2.0E-07
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 45 95 2.0E-07
sp|Q1H9T6|ZBT48_MOUSE Zinc finger and BTB domain-containing protein 48 OS=Mus musculus GN=Zbtb48 PE=1 SV=1 46 94 2.0E-07
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 12 103 2.0E-07
sp|Q5R633|ZBT48_PONAB Zinc finger and BTB domain-containing protein 48 OS=Pongo abelii GN=ZBTB48 PE=2 SV=1 46 96 2.0E-07
sp|Q9QZ48|ZBT7A_RAT Zinc finger and BTB domain-containing protein 7A OS=Rattus norvegicus GN=Zbtb7a PE=1 SV=1 45 127 2.0E-07
sp|Q9US36|KLF1_SCHPO Zinc finger protein klf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klf1 PE=2 SV=1 52 98 2.0E-07
sp|Q5RC79|ZFP1_PONAB Zinc finger protein 1 homolog OS=Pongo abelii GN=ZFP1 PE=2 SV=1 45 153 2.0E-07
sp|Q6P2D0|ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens GN=ZFP1 PE=1 SV=2 45 153 2.0E-07
sp|P18720|ZG42_XENLA Gastrula zinc finger protein XlCGF42.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 45 115 2.0E-07
sp|P18720|ZG42_XENLA Gastrula zinc finger protein XlCGF42.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 45 103 2.0E-07
sp|Q8N8C0|ZN781_HUMAN Zinc finger protein 781 OS=Homo sapiens GN=ZNF781 PE=2 SV=1 45 103 2.0E-07
sp|Q99LI5|ZN281_MOUSE Zinc finger protein 281 OS=Mus musculus GN=Znf281 PE=1 SV=1 45 103 2.0E-07
sp|Q8BI73|ZN775_MOUSE Zinc finger protein 775 OS=Mus musculus GN=Znf775 PE=2 SV=1 45 95 2.0E-07
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 12 111 2.0E-07
sp|Q05159|EGR2B_DANRE Early growth response protein 2b OS=Danio rerio GN=egr2b PE=2 SV=1 45 98 2.0E-07
sp|Q96CX3|ZN501_HUMAN Zinc finger protein 501 OS=Homo sapiens GN=ZNF501 PE=2 SV=2 45 103 2.0E-07
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 45 93 2.0E-07
sp|P18718|ZG3_XENLA Gastrula zinc finger protein xLCGF3.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 45 107 3.0E-07
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 49 103 3.0E-07
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 43 103 3.0E-07
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 49 103 3.0E-07
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 43 103 3.0E-07
sp|P18712|ZG16_XENLA Gastrula zinc finger protein XlCGF16.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 45 95 3.0E-07
sp|Q61624|ZN148_MOUSE Zinc finger protein 148 OS=Mus musculus GN=Znf148 PE=1 SV=2 45 99 3.0E-07
sp|Q3Y4E1|ZN148_BOVIN Zinc finger protein 148 OS=Bos taurus GN=ZNF148 PE=2 SV=1 45 99 3.0E-07
sp|Q9UQR1|ZN148_HUMAN Zinc finger protein 148 OS=Homo sapiens GN=ZNF148 PE=1 SV=2 45 99 3.0E-07
sp|Q62806|ZN148_RAT Zinc finger protein 148 OS=Rattus norvegicus GN=Znf148 PE=1 SV=1 45 99 3.0E-07
sp|Q5R782|ZN148_PONAB Zinc finger protein 148 OS=Pongo abelii GN=ZNF148 PE=2 SV=1 45 99 3.0E-07
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 49 103 3.0E-07
sp|Q08427|EGR2_XENLA Early growth response protein 2 OS=Xenopus laevis GN=egr2 PE=2 SV=1 45 115 3.0E-07
sp|O75123|ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens GN=ZNF623 PE=2 SV=2 45 103 3.0E-07
sp|Q98T94|GLIS2_XENLA Zinc finger protein GLIS2 OS=Xenopus laevis GN=glis2 PE=2 SV=1 45 78 3.0E-07
sp|Q9Y2X9|ZN281_HUMAN Zinc finger protein 281 OS=Homo sapiens GN=ZNF281 PE=1 SV=1 45 103 3.0E-07
sp|P33748|MSN2_YEAST Zinc finger protein MSN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSN2 PE=1 SV=1 45 93 3.0E-07
sp|Q9BWM5|ZN416_HUMAN Zinc finger protein 416 OS=Homo sapiens GN=ZNF416 PE=2 SV=1 13 98 3.0E-07
sp|Q25515|KRUP_MANSE Protein krueppel (Fragment) OS=Manduca sexta GN=Kr PE=2 SV=1 45 108 3.0E-07
sp|O88939|ZBT7A_MOUSE Zinc finger and BTB domain-containing protein 7A OS=Mus musculus GN=Zbtb7a PE=1 SV=2 45 111 3.0E-07
sp|P18726|ZG5A_XENLA Gastrula zinc finger protein XlCGF51.1A (Fragment) OS=Xenopus laevis PE=3 SV=1 48 105 3.0E-07
sp|Q9ER74|SALL1_MOUSE Sal-like protein 1 OS=Mus musculus GN=Sall1 PE=1 SV=1 32 116 3.0E-07
sp|Q6ZS27|ZN662_HUMAN Zinc finger protein 662 OS=Homo sapiens GN=ZNF662 PE=1 SV=1 12 96 3.0E-07
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 45 103 3.0E-07
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 45 103 3.0E-07
sp|P49952|WT1_RAT Wilms tumor protein homolog OS=Rattus norvegicus GN=Wt1 PE=2 SV=1 45 99 3.0E-07
sp|Q9NSC2|SALL1_HUMAN Sal-like protein 1 OS=Homo sapiens GN=SALL1 PE=1 SV=2 32 116 3.0E-07
sp|P22561|WT1_MOUSE Wilms tumor protein homolog OS=Mus musculus GN=Wt1 PE=1 SV=1 45 99 3.0E-07
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 45 107 3.0E-07
sp|Q5R7I8|ZNF19_PONAB Zinc finger protein 19 OS=Pongo abelii GN=ZNF19 PE=2 SV=1 45 103 3.0E-07
sp|O95365|ZBT7A_HUMAN Zinc finger and BTB domain-containing protein 7A OS=Homo sapiens GN=ZBTB7A PE=1 SV=1 45 111 3.0E-07
sp|Q01792|KRUP_BRACO Protein krueppel (Fragment) OS=Bradysia coprophila GN=Kr PE=3 SV=1 45 103 3.0E-07
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 45 111 3.0E-07
sp|P18739|ZO10_XENLA Oocyte zinc finger protein XlCOF10 (Fragment) OS=Xenopus laevis PE=3 SV=1 45 95 3.0E-07
sp|P18718|ZG3_XENLA Gastrula zinc finger protein xLCGF3.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 45 118 4.0E-07
sp|P18735|ZG7_XENLA Gastrula zinc finger protein XlCGF7.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 43 103 4.0E-07
sp|P49953|WT1_SMIMA Wilms tumor protein homolog (Fragment) OS=Sminthopsis macroura GN=WT1 PE=2 SV=1 45 107 4.0E-07
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 45 103 4.0E-07
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 45 95 4.0E-07
sp|Q8JZL0|ZN467_MOUSE Zinc finger protein 467 OS=Mus musculus GN=Znf467 PE=1 SV=1 45 108 4.0E-07
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 49 103 4.0E-07
sp|Q9WUF2|EGR4_MOUSE Early growth response protein 4 OS=Mus musculus GN=Egr4 PE=3 SV=1 45 98 4.0E-07
sp|A6NM28|ZFP92_HUMAN Zinc finger protein 92 homolog OS=Homo sapiens GN=ZFP92 PE=2 SV=3 45 146 4.0E-07
sp|Q00911|EGR4_RAT Early growth response protein 4 OS=Rattus norvegicus GN=Egr4 PE=2 SV=1 45 98 4.0E-07
sp|P18716|ZG28_XENLA Gastrula zinc finger protein XlCGF28.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 45 95 4.0E-07
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 12 103 4.0E-07
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 45 95 4.0E-07
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 45 107 4.0E-07
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 45 95 4.0E-07
sp|P07247|KRUP_DROME Protein krueppel OS=Drosophila melanogaster GN=Kr PE=1 SV=2 48 103 4.0E-07
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 45 103 4.0E-07
sp|B7Z6K7|ZN814_HUMAN Putative uncharacterized zinc finger protein 814 OS=Homo sapiens GN=ZNF814 PE=1 SV=2 45 153 4.0E-07
sp|Q9GL32|EGR4_BOVIN Early growth response protein 4 OS=Bos taurus GN=EGR4 PE=2 SV=1 45 98 4.0E-07
sp|P30373|CKR1_CHICK Zinc finger protein CKR1 OS=Gallus gallus PE=2 SV=1 45 95 4.0E-07
sp|P18735|ZG7_XENLA Gastrula zinc finger protein XlCGF7.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 43 95 5.0E-07
sp|P18732|ZG64_XENLA Gastrula zinc finger protein XlCGF64.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 45 94 5.0E-07
sp|Q5RJR4|ZN467_RAT Zinc finger protein 467 OS=Rattus norvegicus GN=Znf467 PE=2 SV=1 45 108 5.0E-07
sp|Q5HY98|ZN766_HUMAN Zinc finger protein 766 OS=Homo sapiens GN=ZNF766 PE=2 SV=1 45 103 5.0E-07
sp|P17023|ZNF19_HUMAN Zinc finger protein 19 OS=Homo sapiens GN=ZNF19 PE=2 SV=4 45 103 5.0E-07
sp|Q6AZW8|ZN660_HUMAN Zinc finger protein 660 OS=Homo sapiens GN=ZNF660 PE=1 SV=1 45 105 5.0E-07
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 45 94 5.0E-07
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 45 154 5.0E-07
sp|Q6P2A1|PRDM9_DANRE Histone-lysine N-methyltransferase PRDM9 OS=Danio rerio GN=prdm9 PE=2 SV=1 47 94 5.0E-07
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 45 153 5.0E-07
sp|Q86Y25|Z354C_HUMAN Zinc finger protein 354C OS=Homo sapiens GN=ZNF354C PE=2 SV=1 45 103 5.0E-07
sp|Q49A33|Z876P_HUMAN Putative zinc finger protein 876 OS=Homo sapiens GN=ZNF876P PE=5 SV=3 29 103 5.0E-07
sp|Q9Z1D9|ZN394_MOUSE Zinc finger protein 394 OS=Mus musculus GN=Znf394 PE=2 SV=3 45 153 5.0E-07
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 46 103 6.0E-07
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 45 95 6.0E-07
sp|P18742|ZO19_XENLA Oocyte zinc finger protein XlCOF19 (Fragment) OS=Xenopus laevis PE=3 SV=1 45 105 6.0E-07
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 45 103 6.0E-07
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 45 103 6.0E-07
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 45 95 6.0E-07
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 45 140 6.0E-07
sp|Q6BEB4|SP5_HUMAN Transcription factor Sp5 OS=Homo sapiens GN=SP5 PE=2 SV=1 45 99 6.0E-07
sp|Q8VI67|SP7_MOUSE Transcription factor Sp7 OS=Mus musculus GN=Sp7 PE=1 SV=1 45 140 6.0E-07
sp|P18740|ZO14_XENLA Oocyte zinc finger protein XlCOF14 (Fragment) OS=Xenopus laevis PE=3 SV=1 49 94 6.0E-07
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 45 95 6.0E-07
sp|P51815|ZN75D_HUMAN Zinc finger protein 75D OS=Homo sapiens GN=ZNF75D PE=2 SV=2 45 120 6.0E-07
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 45 103 6.0E-07
sp|Q9JHX2|SP5_MOUSE Transcription factor Sp5 OS=Mus musculus GN=Sp5 PE=2 SV=1 45 99 6.0E-07
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 44 109 6.0E-07
sp|Q9ERU2|ZNF22_RAT Zinc finger protein 22 OS=Rattus norvegicus GN=Znf22 PE=2 SV=2 45 103 7.0E-07
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 45 96 7.0E-07
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 46 94 7.0E-07
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 14 153 7.0E-07
sp|Q99LI5|ZN281_MOUSE Zinc finger protein 281 OS=Mus musculus GN=Znf281 PE=1 SV=1 43 95 7.0E-07
sp|Q96CX3|ZN501_HUMAN Zinc finger protein 501 OS=Homo sapiens GN=ZNF501 PE=2 SV=2 49 98 7.0E-07
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 45 95 7.0E-07
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 45 103 7.0E-07
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 45 95 7.0E-07
sp|A2T736|ZKSC8_PANTR Zinc finger protein with KRAB and SCAN domains 8 OS=Pan troglodytes GN=ZKSCAN8 PE=3 SV=1 45 103 7.0E-07
sp|A1YG60|ZKSC8_PANPA Zinc finger protein with KRAB and SCAN domains 8 OS=Pan paniscus GN=ZKSCAN8 PE=3 SV=1 45 103 7.0E-07
sp|P18727|ZG52_XENLA Gastrula zinc finger protein XlCGF52.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 45 103 7.0E-07
sp|Q9VI93|RN_DROME Zinc finger protein rotund OS=Drosophila melanogaster GN=rn PE=1 SV=2 45 103 7.0E-07
sp|Q15776|ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens GN=ZKSCAN8 PE=1 SV=2 45 103 7.0E-07
sp|P16372|ZFP58_MOUSE Zinc finger protein 58 OS=Mus musculus GN=Zfp58 PE=2 SV=2 45 94 7.0E-07
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 12 103 7.0E-07
sp|Q571J5|Z354C_MOUSE Zinc finger protein 354C OS=Mus musculus GN=Znf354c PE=2 SV=2 45 95 7.0E-07
sp|P19544|WT1_HUMAN Wilms tumor protein OS=Homo sapiens GN=WT1 PE=1 SV=2 40 96 8.0E-07
sp|O62651|WT1_PIG Wilms tumor protein homolog OS=Sus scrofa GN=WT1 PE=2 SV=1 40 96 8.0E-07
sp|Q9Y2X9|ZN281_HUMAN Zinc finger protein 281 OS=Homo sapiens GN=ZNF281 PE=1 SV=1 43 95 8.0E-07
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 45 103 8.0E-07
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 45 103 8.0E-07
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 45 95 8.0E-07
sp|P52741|ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens GN=ZNF134 PE=2 SV=2 45 95 8.0E-07
sp|Q8IWY8|ZSC29_HUMAN Zinc finger and SCAN domain-containing protein 29 OS=Homo sapiens GN=ZSCAN29 PE=1 SV=2 45 93 8.0E-07
sp|O43829|ZBT14_HUMAN Zinc finger and BTB domain-containing protein 14 OS=Homo sapiens GN=ZBTB14 PE=1 SV=2 45 105 8.0E-07
sp|A0MS83|ZN148_DANRE Zinc finger protein 148 OS=Danio rerio GN=znf148 PE=2 SV=2 45 99 8.0E-07
sp|P18737|ZG8_XENLA Gastrula zinc finger protein XlCGF8.2DB (Fragment) OS=Xenopus laevis PE=3 SV=1 45 103 8.0E-07
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 45 148 8.0E-07
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 12 103 8.0E-07
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 45 103 8.0E-07
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 45 95 8.0E-07
sp|Q96EG3|ZN837_HUMAN Zinc finger protein 837 OS=Homo sapiens GN=ZNF837 PE=2 SV=2 45 107 8.0E-07
sp|P18750|ZO61_XENLA Oocyte zinc finger protein XlCOF6.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 45 105 9.0E-07
sp|P18713|ZG17_XENLA Gastrula zinc finger protein XlCGF17.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 45 93 9.0E-07
sp|Q96N20|ZN75A_HUMAN Zinc finger protein 75A OS=Homo sapiens GN=ZNF75A PE=2 SV=1 45 111 9.0E-07
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 13 105 9.0E-07
sp|P18724|ZG49_XENLA Gastrula zinc finger protein XlCGF49.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 45 98 9.0E-07
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 45 95 9.0E-07
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 45 103 9.0E-07
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 45 94 9.0E-07
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 45 95 9.0E-07
sp|P49952|WT1_RAT Wilms tumor protein homolog OS=Rattus norvegicus GN=Wt1 PE=2 SV=1 40 96 9.0E-07
sp|P22561|WT1_MOUSE Wilms tumor protein homolog OS=Mus musculus GN=Wt1 PE=1 SV=1 40 96 9.0E-07
sp|P18727|ZG52_XENLA Gastrula zinc finger protein XlCGF52.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 46 103 9.0E-07
sp|Q5RAU9|ZN131_PONAB Zinc finger protein 131 OS=Pongo abelii GN=ZNF131 PE=2 SV=1 45 93 9.0E-07
sp|P18733|ZG66_XENLA Gastrula zinc finger protein XlCGF66.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 49 105 9.0E-07
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 12 103 9.0E-07
sp|P20385|CF2_DROME Chorion transcription factor Cf2 OS=Drosophila melanogaster GN=Cf2 PE=2 SV=3 41 93 9.0E-07
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 45 95 9.0E-07
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 45 95 9.0E-07
sp|P18736|ZG71_XENLA Gastrula zinc finger protein XlCGF71.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 43 105 1.0E-06
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 45 95 1.0E-06
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 45 95 1.0E-06
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 45 94 1.0E-06
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 45 95 1.0E-06
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 45 93 1.0E-06
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 45 103 1.0E-06
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 45 103 1.0E-06
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 45 93 1.0E-06
sp|P50902|WT1_ALLMI Wilms tumor protein homolog (Fragment) OS=Alligator mississippiensis GN=WT1 PE=2 SV=1 40 96 1.0E-06
sp|Q5RF70|ZN501_PONAB Zinc finger protein 501 OS=Pongo abelii GN=ZNF501 PE=2 SV=3 49 98 1.0E-06
sp|P26632|EGR1_DANRE Early growth response protein 1 OS=Danio rerio GN=egr1 PE=2 SV=2 45 93 1.0E-06
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 45 153 1.0E-06
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 45 103 1.0E-06
sp|Q5T5D7|ZN684_HUMAN Zinc finger protein 684 OS=Homo sapiens GN=ZNF684 PE=2 SV=1 45 94 1.0E-06
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 42 103 1.0E-06
sp|Q15973|ZN124_HUMAN Zinc finger protein 124 OS=Homo sapiens GN=ZNF124 PE=1 SV=2 49 103 1.0E-06
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 45 95 1.0E-06
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 45 95 1.0E-06
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 45 103 1.0E-06
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 45 103 1.0E-06
sp|P18727|ZG52_XENLA Gastrula zinc finger protein XlCGF52.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 45 103 1.0E-06
sp|P18737|ZG8_XENLA Gastrula zinc finger protein XlCGF8.2DB (Fragment) OS=Xenopus laevis PE=3 SV=1 13 105 1.0E-06
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 45 95 1.0E-06
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 45 95 1.0E-06
sp|Q9Z2K3|ZN394_RAT Zinc finger protein 394 OS=Rattus norvegicus GN=Znf394 PE=2 SV=1 14 95 1.0E-06
sp|A2T7D2|ZKSC5_PANTR Zinc finger protein with KRAB and SCAN domains 5 OS=Pan troglodytes GN=ZKSCAN5 PE=3 SV=1 45 107 1.0E-06
sp|Q03112|EVI1_HUMAN MDS1 and EVI1 complex locus protein EVI1 OS=Homo sapiens GN=MECOM PE=1 SV=2 45 159 1.0E-06
sp|Q6ZN11|ZN793_HUMAN Zinc finger protein 793 OS=Homo sapiens GN=ZNF793 PE=2 SV=2 39 95 1.0E-06
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 45 103 1.0E-06
sp|Q9Y2L8|ZKSC5_HUMAN Zinc finger protein with KRAB and SCAN domains 5 OS=Homo sapiens GN=ZKSCAN5 PE=1 SV=1 45 107 1.0E-06
sp|Q08376|ZBT14_MOUSE Zinc finger and BTB domain-containing protein 14 OS=Mus musculus GN=Zbtb14 PE=2 SV=1 45 105 1.0E-06
sp|Q05215|EGR4_HUMAN Early growth response protein 4 OS=Homo sapiens GN=EGR4 PE=2 SV=3 45 98 1.0E-06
sp|P18741|ZO15_XENLA Oocyte zinc finger protein XlCOF15 (Fragment) OS=Xenopus laevis PE=3 SV=1 45 103 1.0E-06
sp|P19538|CI_DROME Transcriptional activator cubitus interruptus OS=Drosophila melanogaster GN=ci PE=1 SV=2 45 250 1.0E-06
sp|Q92010|ZBT14_CHICK Zinc finger and BTB domain-containing protein 14 OS=Gallus gallus GN=ZBTB14 PE=2 SV=1 45 98 1.0E-06
sp|Q96ND8|ZN583_HUMAN Zinc finger protein 583 OS=Homo sapiens GN=ZNF583 PE=2 SV=2 45 103 1.0E-06
sp|Q09838|PRZ1_SCHPO Transcriptional regulator prz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prz1 PE=1 SV=1 45 95 1.0E-06
sp|P54785|MOT3_YEAST Transcriptional activator/repressor MOT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MOT3 PE=1 SV=1 1 98 1.0E-06
sp|Q6P9A1|ZN530_HUMAN Zinc finger protein 530 OS=Homo sapiens GN=ZNF530 PE=2 SV=2 45 129 1.0E-06
sp|Q6P9A1|ZN530_HUMAN Zinc finger protein 530 OS=Homo sapiens GN=ZNF530 PE=2 SV=2 43 95 1.0E-06
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 12 103 1.0E-06
sp|Q62513|ZN260_MOUSE Zinc finger protein 260 OS=Mus musculus GN=Znf260 PE=1 SV=1 45 94 1.0E-06
sp|P52739|ZN131_HUMAN Zinc finger protein 131 OS=Homo sapiens GN=ZNF131 PE=1 SV=2 44 93 1.0E-06
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 24 104 1.0E-06
sp|Q01871|KRUP_EUSPL Protein krueppel (Fragment) OS=Euscelis plebejus GN=Kr PE=3 SV=1 45 103 1.0E-06
sp|Q14119|VEZF1_HUMAN Vascular endothelial zinc finger 1 OS=Homo sapiens GN=VEZF1 PE=1 SV=2 47 93 1.0E-06
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 45 153 1.0E-06
sp|Q02525|ZFP39_MOUSE Zinc finger protein 39 OS=Mus musculus GN=Zfp39 PE=2 SV=2 12 94 1.0E-06
sp|Q14929|ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens GN=ZNF169 PE=1 SV=3 45 95 1.0E-06
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 45 153 1.0E-06
sp|Q91VW9|ZKSC3_MOUSE Zinc finger protein with KRAB and SCAN domains 3 OS=Mus musculus GN=Zkscan3 PE=1 SV=1 42 96 1.0E-06
sp|Q9HAZ2|PRD16_HUMAN PR domain zinc finger protein 16 OS=Homo sapiens GN=PRDM16 PE=1 SV=3 45 106 1.0E-06
sp|Q10096|YAOH_SCHPO Zinc finger protein C11D3.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.17 PE=1 SV=1 38 98 1.0E-06
sp|Q642B2|ZN672_RAT Zinc finger protein 672 OS=Rattus norvegicus GN=Znf672 PE=2 SV=1 45 93 1.0E-06
sp|A2A935|PRD16_MOUSE PR domain zinc finger protein 16 OS=Mus musculus GN=Prdm16 PE=1 SV=1 45 106 1.0E-06
sp|Q8C8V1|ZXDC_MOUSE Zinc finger protein ZXDC OS=Mus musculus GN=Zxdc PE=2 SV=1 12 106 1.0E-06
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 45 103 1.0E-06
sp|Q96PE6|ZIM3_HUMAN Zinc finger imprinted 3 OS=Homo sapiens GN=ZIM3 PE=2 SV=1 45 98 1.0E-06
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 12 95 1.0E-06
sp|B5DE03|WT1_XENTR Wilms tumor protein homolog OS=Xenopus tropicalis GN=wt1 PE=2 SV=1 42 96 2.0E-06
sp|Q68DI1|ZN776_HUMAN Zinc finger protein 776 OS=Homo sapiens GN=ZNF776 PE=1 SV=2 16 153 2.0E-06
sp|P18732|ZG64_XENLA Gastrula zinc finger protein XlCGF64.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 45 94 2.0E-06
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 45 94 2.0E-06
sp|B7ZSG3|WT1A_XENLA Wilms tumor protein homolog A OS=Xenopus laevis GN=wt1-a PE=2 SV=1 42 96 2.0E-06
sp|Q5RF70|ZN501_PONAB Zinc finger protein 501 OS=Pongo abelii GN=ZNF501 PE=2 SV=3 45 103 2.0E-06
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 45 95 2.0E-06
sp|Q5RJR4|ZN467_RAT Zinc finger protein 467 OS=Rattus norvegicus GN=Znf467 PE=2 SV=1 45 95 2.0E-06
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 45 95 2.0E-06
sp|Q8JZL0|ZN467_MOUSE Zinc finger protein 467 OS=Mus musculus GN=Znf467 PE=1 SV=1 45 95 2.0E-06
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 46 94 2.0E-06
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 24 94 2.0E-06
sp|Q96CX3|ZN501_HUMAN Zinc finger protein 501 OS=Homo sapiens GN=ZNF501 PE=2 SV=2 45 103 2.0E-06
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 45 103 2.0E-06
sp|Q9WUF2|EGR4_MOUSE Early growth response protein 4 OS=Mus musculus GN=Egr4 PE=3 SV=1 44 93 2.0E-06
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 45 95 2.0E-06
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 45 117 2.0E-06
sp|P30373|CKR1_CHICK Zinc finger protein CKR1 OS=Gallus gallus PE=2 SV=1 21 95 2.0E-06
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 45 95 2.0E-06
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 45 95 2.0E-06
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 45 93 2.0E-06
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 45 103 2.0E-06
sp|A0MS83|ZN148_DANRE Zinc finger protein 148 OS=Danio rerio GN=znf148 PE=2 SV=2 44 103 2.0E-06
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 9 118 2.0E-06
sp|P20385|CF2_DROME Chorion transcription factor Cf2 OS=Drosophila melanogaster GN=Cf2 PE=2 SV=3 45 98 2.0E-06
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 5 103 2.0E-06
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 45 103 2.0E-06
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 42 103 2.0E-06
sp|Q9NYW8|RBAK_HUMAN RB-associated KRAB zinc finger protein OS=Homo sapiens GN=RBAK PE=1 SV=1 5 103 2.0E-06
sp|P26634|EGR2_CERTH E3 SUMO-protein ligase EGR2 (Fragment) OS=Cerdocyon thous GN=EGR2 PE=3 SV=1 45 82 2.0E-06
sp|Q29RZ4|ZNF2_BOVIN Zinc finger protein 2 OS=Bos taurus GN=ZNF2 PE=2 SV=1 4 93 2.0E-06
sp|O95863|SNAI1_HUMAN Zinc finger protein SNAI1 OS=Homo sapiens GN=SNAI1 PE=1 SV=2 46 95 2.0E-06
sp|Q96NJ6|ZFP3_HUMAN Zinc finger protein 3 homolog OS=Homo sapiens GN=ZFP3 PE=2 SV=1 12 103 2.0E-06
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 45 103 2.0E-06
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 45 103 2.0E-06
sp|A8MUZ8|Z705G_HUMAN Putative zinc finger protein 705G OS=Homo sapiens GN=ZNF705G PE=2 SV=2 45 95 2.0E-06
sp|Q99LH4|ZN672_MOUSE Zinc finger protein 672 OS=Mus musculus GN=Znf672 PE=2 SV=1 45 93 2.0E-06
sp|Q91ZD1|OSR2_MOUSE Protein odd-skipped-related 2 OS=Mus musculus GN=Osr2 PE=1 SV=1 45 107 2.0E-06
sp|Q08DS3|OSR1_BOVIN Protein odd-skipped-related 1 OS=Bos taurus GN=OSR1 PE=2 SV=2 45 94 2.0E-06
sp|Q5T619|ZN648_HUMAN Zinc finger protein 648 OS=Homo sapiens GN=ZNF648 PE=2 SV=1 45 95 2.0E-06
sp|Q8N2R0|OSR2_HUMAN Protein odd-skipped-related 2 OS=Homo sapiens GN=OSR2 PE=1 SV=2 45 107 2.0E-06
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 45 103 2.0E-06
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 45 103 2.0E-06
sp|P16415|ZN823_HUMAN Zinc finger protein 823 OS=Homo sapiens GN=ZNF823 PE=2 SV=2 45 103 2.0E-06
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 45 103 2.0E-06
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 45 103 2.0E-06
sp|Q9H7R0|ZN442_HUMAN Zinc finger protein 442 OS=Homo sapiens GN=ZNF442 PE=2 SV=1 45 95 2.0E-06
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 45 94 2.0E-06
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 12 103 2.0E-06
sp|Q9W747|DRL_DANRE Zinc finger protein draculin OS=Danio rerio GN=drl PE=2 SV=2 14 93 2.0E-06
sp|Q8TAX0|OSR1_HUMAN Protein odd-skipped-related 1 OS=Homo sapiens GN=OSR1 PE=2 SV=1 45 94 2.0E-06
sp|P10754|ZFP13_MOUSE Zinc finger protein 13 OS=Mus musculus GN=Zfp13 PE=2 SV=2 45 95 2.0E-06
sp|P52742|ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens GN=ZNF135 PE=2 SV=3 12 103 2.0E-06
sp|Q12041|MET32_YEAST Transcriptional regulator MET32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET32 PE=1 SV=1 49 97 2.0E-06
sp|Q567J8|OSR2_DANRE Protein odd-skipped-related 2 OS=Danio rerio GN=osr2 PE=2 SV=1 45 102 2.0E-06
sp|A6QNZ0|ZSC26_BOVIN Zinc finger and SCAN domain-containing protein 26 OS=Bos taurus GN=ZSCAN26 PE=2 SV=1 12 101 2.0E-06
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 45 94 2.0E-06
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 45 103 2.0E-06
sp|P18723|ZG48_XENLA Gastrula zinc finger protein XlCGF48.2 (Fragment) OS=Xenopus laevis PE=2 SV=1 12 95 2.0E-06
sp|B0K011|OSR1_RAT Protein odd-skipped-related 1 OS=Rattus norvegicus GN=Osr1 PE=2 SV=1 45 94 2.0E-06
sp|Q9WVG7|OSR1_MOUSE Protein odd-skipped-related 1 OS=Mus musculus GN=Osr1 PE=2 SV=1 45 94 2.0E-06
sp|Q86UQ0|ZN589_HUMAN Zinc finger protein 589 OS=Homo sapiens GN=ZNF589 PE=1 SV=1 45 103 2.0E-06
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 45 193 2.0E-06
sp|Q8K2R5|ZN668_MOUSE Zinc finger protein 668 OS=Mus musculus GN=Znf668 PE=2 SV=1 45 107 2.0E-06
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 45 106 2.0E-06
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 45 103 2.0E-06
sp|Q68DY9|ZN772_HUMAN Zinc finger protein 772 OS=Homo sapiens GN=ZNF772 PE=1 SV=2 45 103 2.0E-06
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 14 94 2.0E-06
sp|Q5RJ54|ZSC26_MOUSE Zinc finger and SCAN domain-containing protein 26 OS=Mus musculus GN=Zscan26 PE=2 SV=1 12 98 2.0E-06
sp|Q6ZSB9|ZBT49_HUMAN Zinc finger and BTB domain-containing protein 49 OS=Homo sapiens GN=ZBTB49 PE=1 SV=3 45 98 2.0E-06
sp|Q8VDL9|GLIS2_MOUSE Zinc finger protein GLIS2 OS=Mus musculus GN=Glis2 PE=1 SV=1 45 78 2.0E-06
sp|Q9BY31|ZN717_HUMAN Zinc finger protein 717 OS=Homo sapiens GN=ZNF717 PE=2 SV=2 12 95 2.0E-06
sp|Q4R3I5|ZN668_MACFA Zinc finger protein 668 OS=Macaca fascicularis GN=ZNF668 PE=2 SV=1 45 107 2.0E-06
sp|Q6AY34|OSR2_RAT Protein odd-skipped-related 2 OS=Rattus norvegicus GN=Osr2 PE=2 SV=1 45 94 2.0E-06
sp|Q3T135|OSR2_BOVIN Protein odd-skipped-related 2 OS=Bos taurus GN=OSR2 PE=2 SV=1 45 94 2.0E-06
sp|O75290|Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens GN=ZNF780A PE=2 SV=3 12 153 2.0E-06
sp|O89091|KLF10_MOUSE Krueppel-like factor 10 OS=Mus musculus GN=Klf10 PE=1 SV=1 45 96 2.0E-06
sp|Q2TA17|ZN668_BOVIN Zinc finger protein 668 OS=Bos taurus GN=ZNF668 PE=2 SV=2 45 107 2.0E-06
sp|Q3V080|ZN583_MOUSE Zinc finger protein 583 OS=Mus musculus GN=Znf583 PE=2 SV=1 45 103 2.0E-06
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 42 96 3.0E-06
sp|Q5R4X5|ZNF22_PONAB Zinc finger protein 22 OS=Pongo abelii GN=ZNF22 PE=2 SV=1 45 103 3.0E-06
sp|P17026|ZNF22_HUMAN Zinc finger protein 22 OS=Homo sapiens GN=ZNF22 PE=1 SV=3 45 103 3.0E-06
sp|P43301|EGR3_RAT Early growth response protein 3 OS=Rattus norvegicus GN=Egr3 PE=2 SV=1 45 93 3.0E-06
sp|P43300|EGR3_MOUSE Early growth response protein 3 OS=Mus musculus GN=Egr3 PE=2 SV=2 45 93 3.0E-06
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 45 94 3.0E-06
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 45 94 3.0E-06
sp|Q06889|EGR3_HUMAN Early growth response protein 3 OS=Homo sapiens GN=EGR3 PE=2 SV=1 45 93 3.0E-06
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 45 103 3.0E-06
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 45 103 3.0E-06
sp|P18726|ZG5A_XENLA Gastrula zinc finger protein XlCGF51.1A (Fragment) OS=Xenopus laevis PE=3 SV=1 45 102 3.0E-06
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 45 105 3.0E-06
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 45 93 3.0E-06
sp|P18727|ZG52_XENLA Gastrula zinc finger protein XlCGF52.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 45 98 3.0E-06
sp|P18733|ZG66_XENLA Gastrula zinc finger protein XlCGF66.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 12 98 3.0E-06
sp|Q96NJ6|ZFP3_HUMAN Zinc finger protein 3 homolog OS=Homo sapiens GN=ZFP3 PE=2 SV=1 45 94 3.0E-06
sp|Q5T619|ZN648_HUMAN Zinc finger protein 648 OS=Homo sapiens GN=ZNF648 PE=2 SV=1 45 103 3.0E-06
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 45 94 3.0E-06
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 45 153 3.0E-06
sp|Q8BXX2|ZBT49_MOUSE Zinc finger and BTB domain-containing protein 49 OS=Mus musculus GN=Zbtb49 PE=2 SV=1 45 95 3.0E-06
sp|O08876|KLF10_RAT Krueppel-like factor 10 OS=Rattus norvegicus GN=Klf10 PE=2 SV=1 52 96 3.0E-06
sp|P18748|ZO29_XENLA Oocyte zinc finger protein XlCOF29 OS=Xenopus laevis PE=2 SV=1 45 105 3.0E-06
sp|Q62255|SALL3_MOUSE Sal-like protein 3 OS=Mus musculus GN=Sall3 PE=1 SV=2 32 108 3.0E-06
sp|Q494X3|ZN404_HUMAN Zinc finger protein 404 OS=Homo sapiens GN=ZNF404 PE=1 SV=2 13 94 3.0E-06
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 9 95 3.0E-06
sp|O43361|ZN749_HUMAN Zinc finger protein 749 OS=Homo sapiens GN=ZNF749 PE=1 SV=2 43 98 3.0E-06
sp|Q9BZE0|GLIS2_HUMAN Zinc finger protein GLIS2 OS=Homo sapiens GN=GLIS2 PE=1 SV=2 45 78 3.0E-06
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 45 103 3.0E-06
sp|Q5REN4|ZN248_PONAB Zinc finger protein 248 OS=Pongo abelii GN=ZNF248 PE=2 SV=1 12 95 3.0E-06
sp|Q8BLB0|ZFP3_MOUSE Zinc finger protein 3 OS=Mus musculus GN=Zfp3 PE=2 SV=1 45 94 3.0E-06
sp|Q7L945|ZN627_HUMAN Zinc finger protein 627 OS=Homo sapiens GN=ZNF627 PE=1 SV=1 45 107 3.0E-06
sp|Q9BXA9|SALL3_HUMAN Sal-like protein 3 OS=Homo sapiens GN=SALL3 PE=1 SV=2 32 108 3.0E-06
sp|Q5REF1|ZN181_PONAB Zinc finger protein 181 OS=Pongo abelii GN=ZNF181 PE=2 SV=1 45 103 3.0E-06
sp|Q9EPU7|Z354C_RAT Zinc finger protein 354C OS=Rattus norvegicus GN=Znf354c PE=1 SV=1 45 95 3.0E-06
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 45 107 3.0E-06
sp|Q9BS31|ZN649_HUMAN Zinc finger protein 649 OS=Homo sapiens GN=ZNF649 PE=1 SV=1 45 153 3.0E-06
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 12 101 3.0E-06
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 12 103 3.0E-06
sp|Q8N8Y5|ZFP41_HUMAN Zinc finger protein 41 homolog OS=Homo sapiens GN=ZFP41 PE=2 SV=1 45 96 3.0E-06
sp|Q8N8Y5|ZFP41_HUMAN Zinc finger protein 41 homolog OS=Homo sapiens GN=ZFP41 PE=2 SV=1 45 103 3.0E-06
sp|G3X9G7|ZN809_MOUSE Zinc finger protein 809 OS=Mus musculus GN=Zfp809 PE=2 SV=1 16 95 3.0E-06
sp|Q8NDW4|ZN248_HUMAN Zinc finger protein 248 OS=Homo sapiens GN=ZNF248 PE=2 SV=1 12 95 3.0E-06
sp|P17032|ZN37A_HUMAN Zinc finger protein 37A OS=Homo sapiens GN=ZNF37A PE=2 SV=3 12 154 3.0E-06
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 49 94 3.0E-06
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 45 93 3.0E-06
sp|Q66K89|E4F1_HUMAN Transcription factor E4F1 OS=Homo sapiens GN=E4F1 PE=1 SV=2 45 93 3.0E-06
sp|P97469|SNAI2_MOUSE Zinc finger protein SNAI2 OS=Mus musculus GN=Snai2 PE=1 SV=1 46 95 3.0E-06
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 47 95 3.0E-06
sp|A2T7D7|ZNF24_PANTR Zinc finger protein 24 OS=Pan troglodytes GN=ZNF24 PE=3 SV=1 45 103 3.0E-06
sp|A1YGJ4|ZNF24_PANPA Zinc finger protein 24 OS=Pan paniscus GN=ZNF24 PE=3 SV=1 45 103 3.0E-06
sp|Q7TNK3|ZNF24_RAT Zinc finger protein 24 OS=Rattus norvegicus GN=Znf24 PE=2 SV=1 45 103 3.0E-06
sp|Q5RAE6|ZNF24_PONAB Zinc finger protein 24 OS=Pongo abelii GN=ZNF24 PE=2 SV=1 45 103 3.0E-06
sp|Q2M3W8|ZN181_HUMAN Zinc finger protein 181 OS=Homo sapiens GN=ZNF181 PE=1 SV=1 45 103 3.0E-06
sp|Q6P9G9|ZN449_HUMAN Zinc finger protein 449 OS=Homo sapiens GN=ZNF449 PE=1 SV=3 29 103 3.0E-06
sp|P17028|ZNF24_HUMAN Zinc finger protein 24 OS=Homo sapiens GN=ZNF24 PE=1 SV=4 45 103 3.0E-06
sp|P17041|ZNF32_HUMAN Zinc finger protein 32 OS=Homo sapiens GN=ZNF32 PE=1 SV=2 45 93 3.0E-06
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 40 103 3.0E-06
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 45 95 3.0E-06
sp|P13682|ZNF35_HUMAN Zinc finger protein 35 OS=Homo sapiens GN=ZNF35 PE=2 SV=4 12 103 3.0E-06
sp|A1YFW6|ZN449_PANPA Zinc finger protein 449 OS=Pan paniscus GN=ZNF449 PE=3 SV=1 29 103 3.0E-06
sp|A1YEQ3|ZN449_GORGO Zinc finger protein 449 OS=Gorilla gorilla gorilla GN=ZNF449 PE=3 SV=1 29 103 3.0E-06
sp|Q13118|KLF10_HUMAN Krueppel-like factor 10 OS=Homo sapiens GN=KLF10 PE=1 SV=1 52 96 3.0E-06
sp|Q5RBQ3|ZN549_PONAB Zinc finger protein 549 OS=Pongo abelii GN=ZNF549 PE=2 SV=1 45 103 3.0E-06
sp|Q8CCE9|E4F1_MOUSE Transcription factor E4F1 OS=Mus musculus GN=E4f1 PE=1 SV=2 45 93 3.0E-06
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 28 103 3.0E-06
sp|Q96K58|ZN668_HUMAN Zinc finger protein 668 OS=Homo sapiens GN=ZNF668 PE=1 SV=3 45 107 3.0E-06
sp|P47806|GLI1_MOUSE Zinc finger protein GLI1 OS=Mus musculus GN=Gli1 PE=1 SV=4 45 103 3.0E-06
sp|A2T6W2|ZN449_PANTR Zinc finger protein 449 OS=Pan troglodytes GN=ZNF449 PE=3 SV=1 29 103 3.0E-06
sp|Q6P9A3|ZN549_HUMAN Zinc finger protein 549 OS=Homo sapiens GN=ZNF549 PE=2 SV=2 45 103 3.0E-06
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 12 155 3.0E-06
sp|Q91VN1|ZNF24_MOUSE Zinc finger protein 24 OS=Mus musculus GN=Znf24 PE=1 SV=1 45 103 3.0E-06
sp|Q9ERU3|ZNF22_MOUSE Zinc finger protein 22 OS=Mus musculus GN=Znf22 PE=1 SV=2 45 103 4.0E-06
sp|Q9UDV7|ZN282_HUMAN Zinc finger protein 282 OS=Homo sapiens GN=ZNF282 PE=2 SV=3 43 103 4.0E-06
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 45 95 4.0E-06
sp|Q96BV0|ZN775_HUMAN Zinc finger protein 775 OS=Homo sapiens GN=ZNF775 PE=2 SV=2 45 95 4.0E-06
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 45 96 4.0E-06
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 45 103 4.0E-06
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 12 103 4.0E-06
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 45 153 4.0E-06
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 45 107 4.0E-06
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 2 103 4.0E-06
sp|Q00911|EGR4_RAT Early growth response protein 4 OS=Rattus norvegicus GN=Egr4 PE=2 SV=1 44 93 4.0E-06
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 45 95 4.0E-06
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 43 153 4.0E-06
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 45 95 4.0E-06
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 46 95 4.0E-06
sp|P18741|ZO15_XENLA Oocyte zinc finger protein XlCOF15 (Fragment) OS=Xenopus laevis PE=3 SV=1 45 93 4.0E-06
sp|Q14929|ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens GN=ZNF169 PE=1 SV=3 45 95 4.0E-06
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 45 103 4.0E-06
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 45 95 4.0E-06
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 45 94 4.0E-06
sp|A2T7D7|ZNF24_PANTR Zinc finger protein 24 OS=Pan troglodytes GN=ZNF24 PE=3 SV=1 34 103 4.0E-06
sp|A1YGJ4|ZNF24_PANPA Zinc finger protein 24 OS=Pan paniscus GN=ZNF24 PE=3 SV=1 34 103 4.0E-06
sp|P23803|ODD_DROME Protein odd-skipped OS=Drosophila melanogaster GN=odd PE=2 SV=3 48 170 4.0E-06
sp|O95201|ZN205_HUMAN Zinc finger protein 205 OS=Homo sapiens GN=ZNF205 PE=1 SV=2 45 95 4.0E-06
sp|Q9VQS7|SOB_DROME Protein sister of odd and bowel OS=Drosophila melanogaster GN=sob PE=2 SV=1 45 111 4.0E-06
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 12 103 4.0E-06
sp|Q58DK7|ZN205_BOVIN Zinc finger protein 205 OS=Bos taurus GN=ZNF205 PE=2 SV=1 45 95 4.0E-06
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 45 103 4.0E-06
sp|P21506|ZNF10_HUMAN Zinc finger protein 10 OS=Homo sapiens GN=ZNF10 PE=1 SV=3 43 95 4.0E-06
sp|Q8NB42|ZN527_HUMAN Zinc finger protein 527 OS=Homo sapiens GN=ZNF527 PE=2 SV=2 45 103 4.0E-06
sp|Q8NB42|ZN527_HUMAN Zinc finger protein 527 OS=Homo sapiens GN=ZNF527 PE=2 SV=2 45 103 4.0E-06
sp|Q6P1L6|ZN343_HUMAN Zinc finger protein 343 OS=Homo sapiens GN=ZNF343 PE=1 SV=1 45 94 4.0E-06
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 12 103 4.0E-06
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 12 103 4.0E-06
sp|P86413|OSR1_XENLA Protein odd-skipped-related 1 OS=Xenopus laevis GN=osr1 PE=2 SV=1 45 94 4.0E-06
sp|Q9H7X3|ZN696_HUMAN Zinc finger protein 696 OS=Homo sapiens GN=ZNF696 PE=2 SV=2 2 103 4.0E-06
sp|Q9UL59|ZN214_HUMAN Zinc finger protein 214 OS=Homo sapiens GN=ZNF214 PE=2 SV=2 12 103 4.0E-06
sp|Q66JF8|OSR1_XENTR Protein odd-skipped-related 1 OS=Xenopus tropicalis GN=osr1 PE=2 SV=1 45 94 4.0E-06
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 12 103 4.0E-06
sp|Q80V23|ZNF32_MOUSE Zinc finger protein 32 OS=Mus musculus GN=Znf32 PE=2 SV=1 45 93 4.0E-06
sp|Q6DD87|ZN787_HUMAN Zinc finger protein 787 OS=Homo sapiens GN=ZNF787 PE=1 SV=3 45 107 4.0E-06
sp|Q6NX45|ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens GN=ZNF774 PE=1 SV=2 45 95 4.0E-06
sp|Q5CZA5|ZN805_HUMAN Zinc finger protein 805 OS=Homo sapiens GN=ZNF805 PE=2 SV=3 45 93 4.0E-06
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 12 95 4.0E-06
sp|Q9UDV6|ZN212_HUMAN Zinc finger protein 212 OS=Homo sapiens GN=ZNF212 PE=1 SV=3 48 99 4.0E-06
sp|Q9ERU2|ZNF22_RAT Zinc finger protein 22 OS=Rattus norvegicus GN=Znf22 PE=2 SV=2 45 103 5.0E-06
sp|P19544|WT1_HUMAN Wilms tumor protein OS=Homo sapiens GN=WT1 PE=1 SV=2 45 93 5.0E-06
sp|O62651|WT1_PIG Wilms tumor protein homolog OS=Sus scrofa GN=WT1 PE=2 SV=1 45 93 5.0E-06
sp|Q9H116|GZF1_HUMAN GDNF-inducible zinc finger protein 1 OS=Homo sapiens GN=GZF1 PE=1 SV=1 45 103 5.0E-06
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 45 111 5.0E-06
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 45 95 5.0E-06
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 45 107 5.0E-06
sp|P18723|ZG48_XENLA Gastrula zinc finger protein XlCGF48.2 (Fragment) OS=Xenopus laevis PE=2 SV=1 45 95 5.0E-06
sp|Q8BLB0|ZFP3_MOUSE Zinc finger protein 3 OS=Mus musculus GN=Zfp3 PE=2 SV=1 12 103 5.0E-06
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 45 95 5.0E-06
sp|Q7TNK3|ZNF24_RAT Zinc finger protein 24 OS=Rattus norvegicus GN=Znf24 PE=2 SV=1 34 103 5.0E-06
sp|Q5RAE6|ZNF24_PONAB Zinc finger protein 24 OS=Pongo abelii GN=ZNF24 PE=2 SV=1 34 103 5.0E-06
sp|P17028|ZNF24_HUMAN Zinc finger protein 24 OS=Homo sapiens GN=ZNF24 PE=1 SV=4 34 103 5.0E-06
sp|Q91VN1|ZNF24_MOUSE Zinc finger protein 24 OS=Mus musculus GN=Znf24 PE=1 SV=1 34 103 5.0E-06
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 45 153 5.0E-06
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 12 95 5.0E-06
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 12 107 5.0E-06
sp|Q5JT82|KLF17_HUMAN Krueppel-like factor 17 OS=Homo sapiens GN=KLF17 PE=1 SV=1 45 95 5.0E-06
sp|O14771|ZN213_HUMAN Zinc finger protein 213 OS=Homo sapiens GN=ZNF213 PE=2 SV=2 45 94 5.0E-06
sp|Q5A0E5|NRG1_CANAL Transcriptional regulator NRG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NRG1 PE=2 SV=1 42 112 5.0E-06
sp|Q5VV52|ZN691_HUMAN Zinc finger protein 691 OS=Homo sapiens GN=ZNF691 PE=1 SV=1 26 95 5.0E-06
sp|Q9UL36|ZN236_HUMAN Zinc finger protein 236 OS=Homo sapiens GN=ZNF236 PE=2 SV=2 45 93 5.0E-06
sp|Q9UL36|ZN236_HUMAN Zinc finger protein 236 OS=Homo sapiens GN=ZNF236 PE=2 SV=2 35 96 5.0E-06
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 45 153 5.0E-06
sp|Q9UL58|ZN215_HUMAN Zinc finger protein 215 OS=Homo sapiens GN=ZNF215 PE=2 SV=2 49 98 5.0E-06
sp|Q60980|KLF3_MOUSE Krueppel-like factor 3 OS=Mus musculus GN=Klf3 PE=1 SV=1 45 96 5.0E-06
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 45 95 5.0E-06
sp|Q2TL60|ZN667_MOUSE Zinc finger protein 667 OS=Mus musculus GN=Znf667 PE=2 SV=1 45 103 5.0E-06
sp|O94892|ZN432_HUMAN Zinc finger protein 432 OS=Homo sapiens GN=ZNF432 PE=1 SV=1 18 95 5.0E-06
sp|O08584|KLF6_MOUSE Krueppel-like factor 6 OS=Mus musculus GN=Klf6 PE=2 SV=3 45 96 5.0E-06
sp|B7ZRU9|EVI1A_XENLA MDS1 and EVI1 complex locus protein EVI1-A OS=Xenopus laevis GN=mecom-a PE=1 SV=1 45 96 5.0E-06
sp|Q96HQ0|ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens GN=ZNF419 PE=1 SV=2 45 103 5.0E-06
sp|O35819|KLF6_RAT Krueppel-like factor 6 OS=Rattus norvegicus GN=Klf6 PE=2 SV=2 45 96 5.0E-06
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 12 153 5.0E-06
sp|Q8BIF9|ZN787_MOUSE Zinc finger protein 787 OS=Mus musculus GN=Znf787 PE=2 SV=3 45 107 5.0E-06
sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 OS=Xenopus laevis PE=2 SV=2 45 95 5.0E-06
sp|Q6PG37|ZN790_HUMAN Zinc finger protein 790 OS=Homo sapiens GN=ZNF790 PE=2 SV=2 45 95 5.0E-06
sp|P49910|ZN165_HUMAN Zinc finger protein 165 OS=Homo sapiens GN=ZNF165 PE=1 SV=1 45 93 5.0E-06
sp|Q15697|ZN174_HUMAN Zinc finger protein 174 OS=Homo sapiens GN=ZNF174 PE=1 SV=1 45 103 5.0E-06
sp|Q8K1S5|KLF11_MOUSE Krueppel-like factor 11 OS=Mus musculus GN=Klf11 PE=2 SV=3 45 101 5.0E-06
sp|Q8TAU3|ZN417_HUMAN Zinc finger protein 417 OS=Homo sapiens GN=ZNF417 PE=1 SV=2 45 114 5.0E-06
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 45 93 6.0E-06
sp|B7ZSG3|WT1A_XENLA Wilms tumor protein homolog A OS=Xenopus laevis GN=wt1-a PE=2 SV=1 45 93 6.0E-06
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 45 95 6.0E-06
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 45 95 6.0E-06
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 45 93 6.0E-06
sp|P17030|ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens GN=ZNF25 PE=2 SV=2 2 153 6.0E-06
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 45 95 6.0E-06
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 45 103 6.0E-06
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 45 95 6.0E-06
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 45 107 6.0E-06
sp|P49952|WT1_RAT Wilms tumor protein homolog OS=Rattus norvegicus GN=Wt1 PE=2 SV=1 45 93 6.0E-06
sp|P22561|WT1_MOUSE Wilms tumor protein homolog OS=Mus musculus GN=Wt1 PE=1 SV=1 45 93 6.0E-06
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 47 107 6.0E-06
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 49 103 6.0E-06
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 45 94 6.0E-06
sp|P18733|ZG66_XENLA Gastrula zinc finger protein XlCGF66.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 45 98 6.0E-06
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 45 103 6.0E-06
sp|Q86UQ0|ZN589_HUMAN Zinc finger protein 589 OS=Homo sapiens GN=ZNF589 PE=1 SV=1 5 93 6.0E-06
sp|Q6P1L6|ZN343_HUMAN Zinc finger protein 343 OS=Homo sapiens GN=ZNF343 PE=1 SV=1 45 95 6.0E-06
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 3 153 6.0E-06
sp|Q96GE5|ZN799_HUMAN Zinc finger protein 799 OS=Homo sapiens GN=ZNF799 PE=2 SV=4 45 103 6.0E-06
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 13 103 6.0E-06
sp|Q9VQU9|BOWEL_DROME Protein bowel OS=Drosophila melanogaster GN=bowl PE=1 SV=1 45 107 6.0E-06
sp|P10069|BRLA_EMENI Regulatory protein brlA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=brlA PE=3 SV=1 52 98 6.0E-06
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 45 103 6.0E-06
sp|Q5SVQ8|ZBT41_HUMAN Zinc finger and BTB domain-containing protein 41 OS=Homo sapiens GN=ZBTB41 PE=1 SV=1 49 98 6.0E-06
sp|Q499Z4|ZN672_HUMAN Zinc finger protein 672 OS=Homo sapiens GN=ZNF672 PE=2 SV=2 45 95 6.0E-06
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 6 95 6.0E-06
sp|Q3TDE8|ZN691_MOUSE Zinc finger protein 691 OS=Mus musculus GN=Znf691 PE=2 SV=1 33 95 6.0E-06
sp|Q96JF6|ZN594_HUMAN Zinc finger protein 594 OS=Homo sapiens GN=ZNF594 PE=2 SV=3 45 103 6.0E-06
sp|Q96JF6|ZN594_HUMAN Zinc finger protein 594 OS=Homo sapiens GN=ZNF594 PE=2 SV=3 45 103 6.0E-06
sp|Q90625|ZBT17_CHICK Zinc finger and BTB domain-containing protein 17 (Fragment) OS=Gallus gallus GN=ZBTB17 PE=2 SV=1 42 99 6.0E-06
sp|P08151|GLI1_HUMAN Zinc finger protein GLI1 OS=Homo sapiens GN=GLI1 PE=1 SV=1 45 103 6.0E-06
sp|Q9Y2A4|ZN443_HUMAN Zinc finger protein 443 OS=Homo sapiens GN=ZNF443 PE=2 SV=2 45 95 6.0E-06
sp|Q03081|MET31_YEAST Transcriptional regulator MET31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET31 PE=1 SV=1 49 116 6.0E-06
sp|Q3KQV3|ZN792_HUMAN Zinc finger protein 792 OS=Homo sapiens GN=ZNF792 PE=1 SV=2 46 95 6.0E-06
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 12 103 6.0E-06
sp|Q96SQ5|ZN587_HUMAN Zinc finger protein 587 OS=Homo sapiens GN=ZNF587 PE=1 SV=1 45 114 6.0E-06
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 45 93 6.0E-06
sp|Q5XJQ7|OSR1_DANRE Protein odd-skipped-related 1 OS=Danio rerio GN=osr1 PE=2 SV=1 45 94 6.0E-06
sp|Q6ZNG0|ZN620_HUMAN Zinc finger protein 620 OS=Homo sapiens GN=ZNF620 PE=2 SV=1 49 94 6.0E-06
sp|Q9H4T2|ZSC16_HUMAN Zinc finger and SCAN domain-containing protein 16 OS=Homo sapiens GN=ZSCAN16 PE=1 SV=2 45 95 6.0E-06
sp|Q1LZC0|ZNF22_BOVIN Zinc finger protein 22 OS=Bos taurus GN=ZNF22 PE=2 SV=1 45 103 7.0E-06
sp|B5DE03|WT1_XENTR Wilms tumor protein homolog OS=Xenopus tropicalis GN=wt1 PE=2 SV=1 45 93 7.0E-06
sp|Q9UDV7|ZN282_HUMAN Zinc finger protein 282 OS=Homo sapiens GN=ZNF282 PE=2 SV=3 45 94 7.0E-06
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 45 95 7.0E-06
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 45 94 7.0E-06
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 45 95 7.0E-06
sp|P18742|ZO19_XENLA Oocyte zinc finger protein XlCOF19 (Fragment) OS=Xenopus laevis PE=3 SV=1 40 105 7.0E-06
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 12 93 7.0E-06
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 45 94 7.0E-06
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 45 153 7.0E-06
sp|P18723|ZG48_XENLA Gastrula zinc finger protein XlCGF48.2 (Fragment) OS=Xenopus laevis PE=2 SV=1 45 95 7.0E-06
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 45 103 7.0E-06
sp|Q8BXX2|ZBT49_MOUSE Zinc finger and BTB domain-containing protein 49 OS=Mus musculus GN=Zbtb49 PE=2 SV=1 45 107 7.0E-06
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 45 134 7.0E-06
sp|Q6P1L6|ZN343_HUMAN Zinc finger protein 343 OS=Homo sapiens GN=ZNF343 PE=1 SV=1 45 95 7.0E-06
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 49 105 7.0E-06
sp|Q2TL60|ZN667_MOUSE Zinc finger protein 667 OS=Mus musculus GN=Znf667 PE=2 SV=1 45 95 7.0E-06
sp|Q96HQ0|ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens GN=ZNF419 PE=1 SV=2 45 153 7.0E-06
sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 OS=Xenopus laevis PE=2 SV=2 45 95 7.0E-06
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 45 93 7.0E-06
sp|P18728|ZG53_XENLA Gastrula zinc finger protein XlCGF53.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 42 103 7.0E-06
sp|Q811F1|ZBT41_MOUSE Zinc finger and BTB domain-containing protein 41 OS=Mus musculus GN=Zbtb41 PE=2 SV=4 49 98 7.0E-06
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 45 94 7.0E-06
sp|Q9BS34|ZN670_HUMAN Zinc finger protein 670 OS=Homo sapiens GN=ZNF670 PE=1 SV=1 45 95 7.0E-06
sp|Q6P9Y7|ZFP82_MOUSE Zinc finger protein 82 OS=Mus musculus GN=Zfp82 PE=2 SV=1 12 94 7.0E-06
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 12 103 7.0E-06
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 45 153 7.0E-06
sp|P57682|KLF3_HUMAN Krueppel-like factor 3 OS=Homo sapiens GN=KLF3 PE=1 SV=1 45 96 7.0E-06
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 45 103 7.0E-06
sp|Q96BR6|ZN669_HUMAN Zinc finger protein 669 OS=Homo sapiens GN=ZNF669 PE=2 SV=2 45 95 7.0E-06
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 45 103 7.0E-06
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 45 95 7.0E-06
sp|Q60821|ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus GN=Zbtb17 PE=1 SV=2 42 99 7.0E-06
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 24 103 7.0E-06
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 45 95 8.0E-06
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 45 94 8.0E-06
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 45 95 8.0E-06
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 12 95 8.0E-06
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 45 103 8.0E-06
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 24 103 8.0E-06
sp|P52741|ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens GN=ZNF134 PE=2 SV=2 45 103 8.0E-06
sp|Q96ND8|ZN583_HUMAN Zinc finger protein 583 OS=Homo sapiens GN=ZNF583 PE=2 SV=2 45 153 8.0E-06
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 45 95 8.0E-06
sp|Q8BLB0|ZFP3_MOUSE Zinc finger protein 3 OS=Mus musculus GN=Zfp3 PE=2 SV=1 3 103 8.0E-06
sp|P17032|ZN37A_HUMAN Zinc finger protein 37A OS=Homo sapiens GN=ZNF37A PE=2 SV=3 12 178 8.0E-06
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 45 95 8.0E-06
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 45 103 8.0E-06
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 12 153 8.0E-06
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 12 94 8.0E-06
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 45 103 8.0E-06
sp|Q9NXT0|ZN586_HUMAN Zinc finger protein 586 OS=Homo sapiens GN=ZNF586 PE=2 SV=2 45 95 8.0E-06
sp|Q5HYK9|ZN667_HUMAN Zinc finger protein 667 OS=Homo sapiens GN=ZNF667 PE=2 SV=2 45 95 8.0E-06
sp|Q923B3|NRIF1_MOUSE Neurotrophin receptor-interacting factor 1 OS=Mus musculus GN=Nrif1 PE=1 SV=3 45 95 8.0E-06
sp|P51508|ZNF81_HUMAN Zinc finger protein 81 OS=Homo sapiens GN=ZNF81 PE=1 SV=3 45 103 8.0E-06
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 12 103 8.0E-06
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 45 153 8.0E-06
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 45 95 8.0E-06
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 12 95 8.0E-06
sp|B7ZRM8|EVI1B_XENLA MDS1 and EVI1 complex locus protein EVI1-B OS=Xenopus laevis GN=mecom-b PE=2 SV=1 45 96 8.0E-06
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 12 95 8.0E-06
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 12 103 8.0E-06
sp|Q86YE8|ZN573_HUMAN Zinc finger protein 573 OS=Homo sapiens GN=ZNF573 PE=2 SV=4 45 95 8.0E-06
sp|Q9HBT8|Z286A_HUMAN Zinc finger protein 286A OS=Homo sapiens GN=ZNF286A PE=1 SV=1 45 95 8.0E-06
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 45 95 9.0E-06
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 45 95 9.0E-06
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 45 95 9.0E-06
sp|A2T736|ZKSC8_PANTR Zinc finger protein with KRAB and SCAN domains 8 OS=Pan troglodytes GN=ZKSCAN8 PE=3 SV=1 45 95 9.0E-06
sp|A1YG60|ZKSC8_PANPA Zinc finger protein with KRAB and SCAN domains 8 OS=Pan paniscus GN=ZKSCAN8 PE=3 SV=1 45 95 9.0E-06
sp|Q15776|ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens GN=ZKSCAN8 PE=1 SV=2 45 95 9.0E-06
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 12 98 9.0E-06
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 45 103 9.0E-06
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 12 162 9.0E-06
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 12 94 9.0E-06
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 45 103 9.0E-06
sp|P52738|ZN140_HUMAN Zinc finger protein 140 OS=Homo sapiens GN=ZNF140 PE=2 SV=2 44 103 1.0E-05
sp|Q9GL32|EGR4_BOVIN Early growth response protein 4 OS=Bos taurus GN=EGR4 PE=2 SV=1 44 93 1.0E-05
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 45 95 1.0E-05
sp|O14771|ZN213_HUMAN Zinc finger protein 213 OS=Homo sapiens GN=ZNF213 PE=2 SV=2 45 103 1.0E-05
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 45 95 1.0E-05
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 45 95 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0006351 transcription, DNA-templated Yes
GO:0003676 nucleic acid binding Yes
GO:0005634 nucleus Yes
GO:0008270 zinc ion binding Yes
GO:0044238 primary metabolic process No
GO:0097659 nucleic acid-templated transcription No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0016070 RNA metabolic process No
GO:0032774 RNA biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:0043229 intracellular organelle No
GO:0046872 metal ion binding No
GO:0008152 metabolic process No
GO:0043169 cation binding No
GO:0008150 biological_process No
GO:0044260 cellular macromolecule metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0043226 organelle No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0090304 nucleic acid metabolic process No
GO:0043227 membrane-bounded organelle No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0018130 heterocycle biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0044424 intracellular part No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009058 biosynthetic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0044464 cell part No
GO:1901576 organic substance biosynthetic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0046914 transition metal ion binding No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF
C2H2 zinc finger

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10046
MPNPTPSSGAAVGGTPFSADDSASTITVNTKAPTAFPPPKTDKPRPHVCATCQRSFARLEHLKRHERSHTKEKPF
ECPECARCFARRDLLLRHQQKLHQTSTPSSRPRNRRESASGIAPGQSRARKNSVAGTNPAGPNAAPTSMRPRANT
ISHIDGAAMQMIASANVSVARGMAAHSRHPSLAGLPVHNLDHVFGGMSAALGQRGMQHGLPKLETAQMSNSDFEN
GMRTAPPLAGFSPEFDFEGLLFGPGSTINPNALHYNESPQSMAVEQQPSPFAQGINDVTASQPFDDGLDWLTGFD
HQMSFQTNENVVDESSPSAISTTSQSGISDVMLDGSNHPTPAGTSTMWQPSIMGPPQMTNPFAMDLNGSVFPDLL
NGAPLSPQPASQKINDPYFSTPPPSLSSLSPSVVSGLNAQNLSQTLGFTAGPETPSSLGGGSNGASPVTTISDAT
RTAIVNALSQCPPFGGRKYSITSQNSPLSPQFQSGANAASAQASANLPSTSDLQRFVGAYLTYFHPHLPFLHIPT
LSFDPSSIASSRAHGVGGSGCLALSMAAIGALYEAEHAQSRELFGMAKKMIFFYLDERRKSDARRAEARRNTPAA
DQAAHANGGPAAQSPVWLVQAMLLNVVYGHNGADKTAGDIASTHCAALVSLAQAADLLRPGRADLSAKREAQMAD
EMGWGRSSEQEEHQEWLQWKNMEERKRTLFAVFIMSSLLVAAYNNTPALTNSEISLDLPCDEEFYTAESSAAFFA
KGGVEAAGHNRMTFFDALGELLRTSEKRQKQLALKNDRKGHGDADPPLTELKPSTFGCLILINALHNYIWETRQR
HQGKVWTMEETEKMHRHIEPALKAWQMAWSSNPHHSVERPNPAGMGPLSADAIPLLDLAYVRLFVNLSRSKERFW
QRDWDGVVEELARGDASPEHSQGTSAEPDAFGSPDAAVHDAMSTAVGSSDGGGSGIPGQPTPRREQHLRRAAFYA
ADSLAMSDKLGVTFVDFTSRELPLQSALCAFDCAQVLAEWIATLQDRVGRYLGVLGQDSLDLEQLPAIVLLEEED
VKLLEKVREILTSAELKLSLNTNPDAMSDGEPPVRVDGPGALATKILRLTAFMLDKAAVWPVTHRMGRCLESHAN
HAQARAERSLTSCE*
Coding >Hirsu2|10046
ATGCCGAATCCCACGCCGTCGTCGGGCGCAGCCGTCGGCGGAACCCCGTTCAGCGCGGATGACTCTGCCTCGACC
ATCACCGTAAACACCAAAGCGCCGACCGCCTTCCCCCCCCCCAAAACTGACAAACCGCGACCCCACGTCTGCGCG
ACTTGCCAGCGCTCCTTCGCCCGCCTGGAACATCTGAAGCGCCACGAGCGCTCCCACACCAAGGAGAAGCCGTTT
GAATGCCCCGAATGTGCCCGATGTTTCGCTCGCCGCGACCTGCTGCTGCGGCACCAGCAGAAGCTGCACCAGACG
TCAACGCCCTCGTCACGCCCTCGCAACCGCCGTGAGTCGGCCAGCGGCATTGCCCCGGGCCAGAGTCGAGCTCGT
AAGAACAGTGTGGCCGGCACCAATCCTGCCGGGCCCAATGCCGCGCCGACGTCCATGAGGCCGAGAGCAAACACG
ATCAGTCACATCGACGGTGCCGCCATGCAGATGATTGCGTCGGCCAATGTTTCGGTCGCCCGAGGCATGGCCGCC
CACAGCCGTCATCCGAGCCTTGCCGGCTTGCCCGTCCACAACCTGGACCACGTCTTCGGTGGCATGTCGGCCGCT
CTGGGCCAGCGAGGGATGCAGCACGGCCTGCCCAAGCTGGAGACGGCCCAAATGAGTAACAGCGACTTCGAGAAT
GGCATGCGGACGGCCCCGCCGCTGGCCGGTTTCAGTCCCGAGTTCGATTTCGAAGGTCTCCTGTTCGGGCCCGGC
TCGACCATCAACCCCAACGCCCTCCACTACAACGAGTCTCCGCAGTCGATGGCGGTGGAGCAGCAGCCCTCGCCG
TTCGCCCAAGGCATCAACGACGTGACCGCCAGTCAGCCGTTCGACGATGGCCTCGACTGGCTCACCGGCTTCGAC
CATCAAATGTCTTTCCAGACCAACGAGAACGTGGTGGACGAGTCCAGCCCGTCTGCCATCAGCACGACCAGCCAG
AGCGGGATAAGCGACGTGATGCTCGACGGGTCCAACCATCCGACGCCGGCCGGGACGAGCACCATGTGGCAACCA
TCCATCATGGGCCCTCCGCAGATGACGAACCCCTTTGCGATGGATCTGAATGGGTCGGTCTTTCCTGATCTCCTC
AATGGAGCCCCTCTATCACCCCAGCCAGCTTCTCAAAAGATCAATGACCCGTACTTCTCTACGCCTCCGCCGTCG
CTGAGCTCCCTGAGCCCCTCCGTCGTGTCTGGGCTGAACGCGCAGAACTTGAGCCAGACTCTGGGCTTCACCGCC
GGCCCCGAAACTCCGTCATCCCTCGGCGGCGGGAGCAACGGCGCCTCTCCCGTGACAACGATTTCAGATGCCACG
CGGACTGCCATCGTGAACGCCCTCTCCCAGTGCCCGCCCTTTGGTGGCCGTAAATACTCCATCACGTCGCAGAAC
TCGCCCTTGTCGCCCCAGTTCCAGTCCGGCGCCAACGCAGCCTCCGCCCAGGCATCGGCCAACCTGCCAAGTACC
TCGGACTTGCAGCGTTTCGTGGGAGCCTATCTGACTTACTTCCATCCTCACCTCCCGTTCCTGCACATTCCAACT
CTGTCTTTTGACCCATCCTCCATTGCAAGCAGTCGCGCACACGGTGTAGGCGGTAGCGGGTGCCTGGCGCTGTCC
ATGGCCGCAATCGGCGCTCTTTACGAGGCGGAACACGCTCAGTCGAGGGAGCTTTTCGGCATGGCCAAGAAGATG
ATATTCTTCTATCTCGACGAGAGGAGGAAATCGGATGCCCGCCGGGCCGAGGCCCGTCGCAACACGCCCGCCGCC
GACCAGGCTGCCCACGCCAACGGCGGCCCGGCGGCCCAGTCTCCGGTCTGGCTCGTCCAGGCCATGCTCCTCAAC
GTCGTCTACGGCCACAACGGCGCCGACAAGACGGCCGGCGACATTGCCTCGACGCATTGTGCCGCCCTGGTCAGC
CTCGCCCAGGCCGCCGATCTGCTACGCCCCGGCCGGGCGGACCTCTCGGCAAAGCGAGAGGCCCAGATGGCTGAC
GAGATGGGCTGGGGCCGCAGCAGCGAGCAAGAGGAGCACCAGGAGTGGCTGCAGTGGAAGAACATGGAGGAGCGG
AAACGCACCCTGTTCGCCGTCTTCATCATGTCCAGCCTGCTCGTGGCCGCGTACAACAACACGCCGGCGCTGACC
AACTCGGAGATCTCGCTGGACTTGCCCTGCGACGAGGAGTTTTACACCGCCGAATCCAGCGCCGCATTCTTCGCC
AAGGGCGGCGTCGAAGCCGCGGGGCACAACCGCATGACCTTCTTCGACGCGCTGGGCGAGCTGCTCCGGACGAGC
GAGAAGCGGCAGAAGCAGCTCGCTCTCAAAAACGACCGCAAGGGCCACGGCGACGCCGATCCGCCCCTGACCGAG
TTGAAGCCGAGCACCTTCGGCTGCCTCATCCTGATCAATGCCCTGCACAACTACATCTGGGAGACGCGTCAGCGG
CATCAGGGCAAGGTGTGGACGATGGAGGAGACGGAGAAGATGCACCGGCACATCGAGCCCGCCCTGAAGGCCTGG
CAGATGGCCTGGTCGAGCAACCCTCACCACAGCGTCGAGCGCCCGAACCCGGCCGGCATGGGCCCGCTGTCCGCC
GACGCCATCCCGCTTCTCGACCTCGCCTACGTGCGCCTCTTCGTCAATCTCTCGCGGTCGAAGGAGAGGTTTTGG
CAGCGAGACTGGGACGGGGTCGTCGAGGAGCTGGCTCGCGGGGATGCAAGTCCAGAACACTCGCAGGGCACGAGC
GCGGAGCCCGACGCCTTCGGCTCCCCTGACGCTGCCGTACATGACGCCATGTCGACCGCGGTCGGCTCGTCGGAC
GGCGGCGGATCTGGCATTCCGGGCCAACCGACGCCTCGACGGGAGCAGCATCTGCGCAGGGCCGCCTTCTACGCC
GCCGACTCCCTGGCCATGTCGGACAAGCTGGGCGTGACGTTCGTCGACTTTACGAGCCGGGAGCTTCCCCTCCAG
TCGGCCCTTTGTGCCTTTGACTGCGCCCAGGTTCTGGCCGAGTGGATCGCGACGCTGCAGGACCGGGTCGGTCGT
TATCTGGGAGTCCTAGGACAGGACTCGTTGGACCTTGAGCAGCTGCCGGCCATAGTCCTGCTGGAAGAGGAAGAC
GTCAAGCTCCTGGAGAAGGTACGGGAGATCTTGACGTCGGCGGAGCTGAAGCTCAGCCTAAACACGAACCCGGAC
GCCATGAGCGACGGAGAGCCGCCGGTACGGGTCGACGGCCCCGGGGCCCTGGCGACCAAGATCCTGCGACTGACG
GCCTTCATGCTGGACAAGGCTGCCGTCTGGCCGGTGACGCACCGGATGGGTCGCTGTCTCGAGTCGCACGCGAAC
CACGCGCAGGCCCGAGCAGAGAGGTCCCTGACGTCATGCGAATGA
Transcript >Hirsu2|10046
ATGCCGAATCCCACGCCGTCGTCGGGCGCAGCCGTCGGCGGAACCCCGTTCAGCGCGGATGACTCTGCCTCGACC
ATCACCGTAAACACCAAAGCGCCGACCGCCTTCCCCCCCCCCAAAACTGACAAACCGCGACCCCACGTCTGCGCG
ACTTGCCAGCGCTCCTTCGCCCGCCTGGAACATCTGAAGCGCCACGAGCGCTCCCACACCAAGGAGAAGCCGTTT
GAATGCCCCGAATGTGCCCGATGTTTCGCTCGCCGCGACCTGCTGCTGCGGCACCAGCAGAAGCTGCACCAGACG
TCAACGCCCTCGTCACGCCCTCGCAACCGCCGTGAGTCGGCCAGCGGCATTGCCCCGGGCCAGAGTCGAGCTCGT
AAGAACAGTGTGGCCGGCACCAATCCTGCCGGGCCCAATGCCGCGCCGACGTCCATGAGGCCGAGAGCAAACACG
ATCAGTCACATCGACGGTGCCGCCATGCAGATGATTGCGTCGGCCAATGTTTCGGTCGCCCGAGGCATGGCCGCC
CACAGCCGTCATCCGAGCCTTGCCGGCTTGCCCGTCCACAACCTGGACCACGTCTTCGGTGGCATGTCGGCCGCT
CTGGGCCAGCGAGGGATGCAGCACGGCCTGCCCAAGCTGGAGACGGCCCAAATGAGTAACAGCGACTTCGAGAAT
GGCATGCGGACGGCCCCGCCGCTGGCCGGTTTCAGTCCCGAGTTCGATTTCGAAGGTCTCCTGTTCGGGCCCGGC
TCGACCATCAACCCCAACGCCCTCCACTACAACGAGTCTCCGCAGTCGATGGCGGTGGAGCAGCAGCCCTCGCCG
TTCGCCCAAGGCATCAACGACGTGACCGCCAGTCAGCCGTTCGACGATGGCCTCGACTGGCTCACCGGCTTCGAC
CATCAAATGTCTTTCCAGACCAACGAGAACGTGGTGGACGAGTCCAGCCCGTCTGCCATCAGCACGACCAGCCAG
AGCGGGATAAGCGACGTGATGCTCGACGGGTCCAACCATCCGACGCCGGCCGGGACGAGCACCATGTGGCAACCA
TCCATCATGGGCCCTCCGCAGATGACGAACCCCTTTGCGATGGATCTGAATGGGTCGGTCTTTCCTGATCTCCTC
AATGGAGCCCCTCTATCACCCCAGCCAGCTTCTCAAAAGATCAATGACCCGTACTTCTCTACGCCTCCGCCGTCG
CTGAGCTCCCTGAGCCCCTCCGTCGTGTCTGGGCTGAACGCGCAGAACTTGAGCCAGACTCTGGGCTTCACCGCC
GGCCCCGAAACTCCGTCATCCCTCGGCGGCGGGAGCAACGGCGCCTCTCCCGTGACAACGATTTCAGATGCCACG
CGGACTGCCATCGTGAACGCCCTCTCCCAGTGCCCGCCCTTTGGTGGCCGTAAATACTCCATCACGTCGCAGAAC
TCGCCCTTGTCGCCCCAGTTCCAGTCCGGCGCCAACGCAGCCTCCGCCCAGGCATCGGCCAACCTGCCAAGTACC
TCGGACTTGCAGCGTTTCGTGGGAGCCTATCTGACTTACTTCCATCCTCACCTCCCGTTCCTGCACATTCCAACT
CTGTCTTTTGACCCATCCTCCATTGCAAGCAGTCGCGCACACGGTGTAGGCGGTAGCGGGTGCCTGGCGCTGTCC
ATGGCCGCAATCGGCGCTCTTTACGAGGCGGAACACGCTCAGTCGAGGGAGCTTTTCGGCATGGCCAAGAAGATG
ATATTCTTCTATCTCGACGAGAGGAGGAAATCGGATGCCCGCCGGGCCGAGGCCCGTCGCAACACGCCCGCCGCC
GACCAGGCTGCCCACGCCAACGGCGGCCCGGCGGCCCAGTCTCCGGTCTGGCTCGTCCAGGCCATGCTCCTCAAC
GTCGTCTACGGCCACAACGGCGCCGACAAGACGGCCGGCGACATTGCCTCGACGCATTGTGCCGCCCTGGTCAGC
CTCGCCCAGGCCGCCGATCTGCTACGCCCCGGCCGGGCGGACCTCTCGGCAAAGCGAGAGGCCCAGATGGCTGAC
GAGATGGGCTGGGGCCGCAGCAGCGAGCAAGAGGAGCACCAGGAGTGGCTGCAGTGGAAGAACATGGAGGAGCGG
AAACGCACCCTGTTCGCCGTCTTCATCATGTCCAGCCTGCTCGTGGCCGCGTACAACAACACGCCGGCGCTGACC
AACTCGGAGATCTCGCTGGACTTGCCCTGCGACGAGGAGTTTTACACCGCCGAATCCAGCGCCGCATTCTTCGCC
AAGGGCGGCGTCGAAGCCGCGGGGCACAACCGCATGACCTTCTTCGACGCGCTGGGCGAGCTGCTCCGGACGAGC
GAGAAGCGGCAGAAGCAGCTCGCTCTCAAAAACGACCGCAAGGGCCACGGCGACGCCGATCCGCCCCTGACCGAG
TTGAAGCCGAGCACCTTCGGCTGCCTCATCCTGATCAATGCCCTGCACAACTACATCTGGGAGACGCGTCAGCGG
CATCAGGGCAAGGTGTGGACGATGGAGGAGACGGAGAAGATGCACCGGCACATCGAGCCCGCCCTGAAGGCCTGG
CAGATGGCCTGGTCGAGCAACCCTCACCACAGCGTCGAGCGCCCGAACCCGGCCGGCATGGGCCCGCTGTCCGCC
GACGCCATCCCGCTTCTCGACCTCGCCTACGTGCGCCTCTTCGTCAATCTCTCGCGGTCGAAGGAGAGGTTTTGG
CAGCGAGACTGGGACGGGGTCGTCGAGGAGCTGGCTCGCGGGGATGCAAGTCCAGAACACTCGCAGGGCACGAGC
GCGGAGCCCGACGCCTTCGGCTCCCCTGACGCTGCCGTACATGACGCCATGTCGACCGCGGTCGGCTCGTCGGAC
GGCGGCGGATCTGGCATTCCGGGCCAACCGACGCCTCGACGGGAGCAGCATCTGCGCAGGGCCGCCTTCTACGCC
GCCGACTCCCTGGCCATGTCGGACAAGCTGGGCGTGACGTTCGTCGACTTTACGAGCCGGGAGCTTCCCCTCCAG
TCGGCCCTTTGTGCCTTTGACTGCGCCCAGGTTCTGGCCGAGTGGATCGCGACGCTGCAGGACCGGGTCGGTCGT
TATCTGGGAGTCCTAGGACAGGACTCGTTGGACCTTGAGCAGCTGCCGGCCATAGTCCTGCTGGAAGAGGAAGAC
GTCAAGCTCCTGGAGAAGGTACGGGAGATCTTGACGTCGGCGGAGCTGAAGCTCAGCCTAAACACGAACCCGGAC
GCCATGAGCGACGGAGAGCCGCCGGTACGGGTCGACGGCCCCGGGGCCCTGGCGACCAAGATCCTGCGACTGACG
GCCTTCATGCTGGACAAGGCTGCCGTCTGGCCGGTGACGCACCGGATGGGTCGCTGTCTCGAGTCGCACGCGAAC
CACGCGCAGGCCCGAGCAGAGAGGTCCCTGACGTCATGCGAATGA
Gene >Hirsu2|10046
ATGCCGAATCCCACGCCGTCGTCGGGCGCAGCCGTCGGCGGAACCCCGTTCAGCGCGGATGACTCTGGTGAGCCT
AAAGTCTACTTGACGAACGGCCAAACCCCAATACCCGTCTGCTCCCAGGATAACACCTACCTACCTGCCTTCATC
CTGCCTCTCCTTGCCTTGGAAGCCTCTCTCCTCCCTCTCGAGCCGCCCTCGCACCCTCACCCTCTCGCTCTCGCT
CTCGCTCTCGCTCCATCTCGCTCCATCTCTCCCTCCTTCTCTCTCTCTGTCCCTCCTCGATTCCCCACGCTGACC
GCCACCTTTTGGATCCCCTCCCCCCACTCCGGCCTGCTTGTCTCGCTCGCTCTTCGTGGCCGCTAATTGCTTCCC
ATGCTCCAGCCTCGACCATCACCGTAAACACCAAAGCGCCGACCGCCTTCCCCCCCCCCAAAACTGACAAACCGC
GACCCCACGTCTGCGCGACTTGCCAGCGCTCCTTCGCCCGCCTGGAACATCTGAAGCGCCACGAGCGCTCCCACA
CCAAGGAGAAGCCGTTTGAATGCCCCGAATGTGCCCGATGTTTCGCTCGCCGCGACCTGCTGCTGCGGCACCAGC
AGAAGCTGCACCAGACGTCAACGCCCTCGTCACGCCCTCGCAACCGCCGTGAGTCGGCCAGCGGCATTGCCCCGG
GCCAGAGTCGAGCTCGTAAGAACAGTGTGGCCGGCACCAATCCTGCCGGGCCCAATGCCGCGCCGACGTCCATGA
GGCCGAGAGCAAACACGATCAGTCACATCGACGGTGCCGCCATGCAGATGATTGCGTCGGCCAATGTTTCGGTCG
CCCGAGGCATGGCCGCCCACAGCCGTCATCCGAGCCTTGCCGGCTTGCCCGTCCACAACCTGGACCACGTCTTCG
GTGGCATGTCGGCCGCTCTGGGCCAGCGAGGGATGCAGCACGGCCTGCCCAAGCTGGAGACGGCCCAAATGAGTA
ACAGCGACTTCGAGAATGGCATGCGGACGGCCCCGCCGCTGGCCGGTTTCAGTCCCGAGTTCGATTTCGAAGGTC
TCCTGTTCGGGCCCGGCTCGACCATCAACCCCAACGCCCTCCACTACAACGAGTCTCCGCAGTCGATGGCGGTGG
AGCAGCAGCCCTCGCCGTTCGCCCAAGGCATCAACGACGTGACCGCCAGTCAGCCGTTCGACGATGGCCTCGACT
GGCTCACCGGCTTCGACCATCAAATGTCTTTCCAGACCAACGAGAACGTGGTGGACGAGTCCAGCCCGTCTGCCA
TCAGCACGACCAGCCAGAGCGGGATAAGCGACGTGATGCTCGACGGGTCCAACCATCCGACGCCGGCCGGGACGA
GCACCATGTGGCAACCATCCATCATGGGCCCTCCGCAGATGACGAACCCCTTTGCGATGGATCTGAATGGGTCGG
TCTTTCCTGATCTCCTCAATGGAGCCCCTCTATCACCCCAGCCAGCTTCTCAAAAGATCAATGACCCGTACTTCT
CTACGCCTCCGCCGTCGCTGAGCTCCCTGAGCCCCTCCGTCGTGTCTGGGCTGAACGCGCAGAACTTGAGCCAGA
CTCTGGGCTTCACCGCCGGCCCCGAAACTCCGTCATCCCTCGGCGGCGGGAGCAACGGCGCCTCTCCCGTGACAA
CGATTTCAGATGCCACGCGGACTGCCATCGTGAACGCCCTCTCCCAGTGCCCGCCCTTTGGTGGCCGTAAATACT
CCATCACGTCGCAGAACTCGCCCTTGTCGCCCCAGTTCCAGTCCGGCGCCAACGCAGCCTCCGCCCAGGCATCGG
CCAACCTGCCAAGTACCTCGGACTTGCAGCGTTTCGTGGGAGCCTATCTGACTTACTTCCATCCTCACCTCCCGT
TCCTGCACATTCCAACTCTGTCTTTTGACCCATCCTCCATTGCAAGCAGTCGCGCACACGGTGTAGGCGGTAGCG
GGTGCCTGGCGCTGTCCATGGCCGCAATCGGCGCTCTTTACGAGGCGGAACACGCTCAGTCGAGGGAGCTTTTCG
GCATGGCCAAGAAGATGATATTCTTCTATCTCGACGAGAGGAGGAAATCGGATGCCCGCCGGGCCGAGGCCCGTC
GCAACACGCCCGCCGCCGACCAGGCTGCCCACGCCAACGGCGGCCCGGCGGCCCAGTCTCCGGTCTGGCTCGTCC
AGGCCATGCTCCTCAACGTCGTCTACGGCCACAACGGCGCCGACAAGACGGCCGGCGACATTGCCTCGACGCATT
GTGCCGCCCTGGTCAGCCTCGCCCAGGCCGCCGATCTGCTACGCCCCGGCCGGGCGGACCTCTCGGCAAAGCGAG
AGGCCCAGATGGCTGACGAGATGGGCTGGGGCCGCAGCAGCGAGCAAGAGGAGCACCAGGAGTGGCTGCAGTGGA
AGAACATGGAGGAGCGGAAACGCACCCTGTTCGCCGTCTTCATCATGTCCAGCCTGCTCGTGGCCGCGTACAACA
ACACGCCGGCGCTGACCAACTCGGAGATCTCGCTGGACTTGCCCTGCGACGAGGAGTTTTACACCGCCGAATCCA
GCGCCGCATTCTTCGCCAAGGGCGGCGTCGAAGCCGCGGGGCACAACCGCATGACCTTCTTCGACGCGCTGGGCG
AGCTGCTCCGGACGAGCGAGAAGCGGCAGAAGCAGCTCGCTCTCAAAAACGACCGCAAGGGCCACGGCGACGCCG
ATCCGCCCCTGACCGAGTTGAAGCCGAGCACCTTCGGCTGCCTCATCCTGATCAATGCCCTGCACAACTACATCT
GGGAGACGCGTCAGCGGCATCAGGGCAAGGTGTGGACGATGGAGGAGACGGAGAAGATGCACCGGCACATCGAGC
CCGCCCTGAAGGCCTGGCAGATGGCCTGGTCGAGCAACCCTCACCACAGCGTCGAGCGCCCGAACCCGGCCGGCA
TGGGCCCGCTGTCCGCCGACGCCATCCCGCTTCTCGACCTCGCCTACGTGCGCCTCTTCGTCAATCTCTCGCGGT
CGAAGGAGAGGTTTTGGCAGCGAGACTGGGACGGGGTCGTCGAGGAGCTGGCTCGCGGGGATGCAAGTCCAGAAC
ACTCGCAGGGCACGAGCGCGGAGCCCGACGCCTTCGGCTCCCCTGACGCTGCCGTACATGACGCCATGTCGACCG
CGGTCGGCTCGTCGGACGGCGGCGGATCTGGCATTCCGGGCCAACCGACGCCTCGACGGGAGCAGCATCTGCGCA
GGGCCGCCTTCTACGCCGCCGACTCCCTGGCCATGTCGGACAAGCTGGGCGTGACGTTCGTCGACTTTACGAGCC
GGGAGCTTCCCCTCCAGTCGGCCCTTTGTGCCTTTGACTGCGCCCAGGTTCTGGCCGAGTGGATCGCGACGCTGC
AGGACCGGGTCGGTCGTTATCTGGGAGTCCTAGGACAGGACTCGTTGGACCTTGAGCAGCTGCCGGCCATAGTCC
TGCTGGAAGAGGAAGACGTCAAGCTCCTGGAGAAGGTACGGGAGATCTTGACGTCGGCGGAGCTGAAGCTCAGCC
TAAACACGAACCCGGACGCCATGAGCGACGGAGAGCCGCCGGTACGGGTCGACGGCCCCGGGGCCCTGGCGACCA
AGATCCTGCGACTGACGGCCTTCATGCTGGACAAGGCTGCCGTCTGGCCGGTGACGCACCGGATGGGTCGCTGTC
TCGAGTCGCACGCGAACCACGCGCAGGCCCGAGCAGAGAGGTCCCTGACGTCATGCGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail