Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10041
Gene name
LocationContig_78:7087..7612
Strand-
Gene length (bp)525
Transcript length (bp)525
Coding sequence length (bp)525
Protein length (aa) 175

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00188 CAP Cysteine-rich secretory protein family 1.1E-12 45 148

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36110|PRY2_YEAST Protein PRY2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY2 PE=1 SV=1 38 169 3.0E-32
sp|P47032|PRY1_YEAST Protein PRY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY1 PE=1 SV=1 58 169 9.0E-30
sp|Q59ZX3|RBE1_CANAL Repressed by EFG1 protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RBE1 PE=1 SV=1 38 163 3.0E-29
sp|P47033|PRY3_YEAST Cell wall protein PRY3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY3 PE=1 SV=1 38 169 3.0E-27
sp|P35792|PR12_HORVU Pathogenesis-related protein PRB1-2 OS=Hordeum vulgare PE=2 SV=1 43 164 4.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36110|PRY2_YEAST Protein PRY2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY2 PE=1 SV=1 38 169 3.0E-32
sp|P47032|PRY1_YEAST Protein PRY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY1 PE=1 SV=1 58 169 9.0E-30
sp|Q59ZX3|RBE1_CANAL Repressed by EFG1 protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RBE1 PE=1 SV=1 38 163 3.0E-29
sp|P47033|PRY3_YEAST Cell wall protein PRY3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY3 PE=1 SV=1 38 169 3.0E-27
sp|P35792|PR12_HORVU Pathogenesis-related protein PRB1-2 OS=Hordeum vulgare PE=2 SV=1 43 164 4.0E-25
sp|Q05968|PR1_HORVU Pathogenesis-related protein 1 OS=Hordeum vulgare PE=2 SV=1 43 164 2.0E-24
sp|Q59PV6|PRY1_CANAL Secreted protein PRY1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRY1 PE=1 SV=1 37 169 6.0E-22
sp|P35793|PR13_HORVU Pathogenesis-related protein PRB1-3 OS=Hordeum vulgare PE=2 SV=1 60 164 7.0E-22
sp|Q40374|PR1_MEDTR Pathogenesis-related protein PR-1 OS=Medicago truncatula GN=PR-1 PE=2 SV=1 33 164 2.0E-21
sp|Q00008|PRMS_MAIZE Pathogenesis-related protein PRMS OS=Zea mays GN=PRMS PE=2 SV=1 6 163 3.0E-20
sp|Q5AB49|Y6200_CANAL Probable pathogenesis-related protein CaO19.6200 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.13580 PE=2 SV=1 37 174 3.0E-20
sp|Q9ZNS4|PRB1_ARATH Pathogenesis-related protein 1 OS=Arabidopsis thaliana GN=PRB1 PE=2 SV=1 33 164 2.0E-19
sp|P33154|PR1_ARATH Pathogenesis-related protein 1 OS=Arabidopsis thaliana GN=At2g14610 PE=1 SV=1 4 160 1.0E-18
sp|Q59WG5|Y2336_CANAL Probable pathogenesis-related protein CaO19.2336 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.2336 PE=2 SV=1 38 169 2.0E-18
sp|P07053|PR1B_TOBAC Pathogenesis-related protein 1B OS=Nicotiana tabacum PE=2 SV=1 36 164 3.0E-18
sp|Q08697|PR1A_SOLLC Pathogenesis-related protein 1A1 OS=Solanum lycopersicum PE=2 SV=1 36 167 6.0E-18
sp|P09042|PR1C_TOBAC Pathogenesis-related protein 1C OS=Nicotiana tabacum PE=2 SV=3 36 164 3.0E-17
sp|P11670|PRB1_TOBAC Basic form of pathogenesis-related protein 1 OS=Nicotiana tabacum PE=3 SV=1 43 167 3.0E-17
sp|P08299|PR1A_TOBAC Pathogenesis-related protein 1A OS=Nicotiana tabacum PE=1 SV=1 36 164 1.0E-16
sp|Q41359|PR1_SAMNI Pathogenesis-related protein PR-1 type OS=Sambucus nigra PE=2 SV=1 50 164 5.0E-16
sp|Q04108|PR04_SOLLC Pathogenesis-related leaf protein 4 OS=Solanum lycopersicum PE=2 SV=1 34 164 5.0E-13
sp|Q5AB48|RBT4_CANAL Secreted protein RBT4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RBT4 PE=1 SV=2 38 163 9.0E-13
sp|Q41495|ST14_SOLTU STS14 protein OS=Solanum tuberosum GN=STS14 PE=2 SV=1 50 164 1.0E-12
sp|P04284|PR06_SOLLC Pathogenesis-related leaf protein 6 OS=Solanum lycopersicum GN=PR1B1 PE=1 SV=2 43 164 1.0E-12
sp|D4B327|PRY1_ARTBC Probable pathogenesis-related protein ARB_02861 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02861 PE=3 SV=2 47 169 4.0E-12
sp|Q6UXB8|PI16_HUMAN Peptidase inhibitor 16 OS=Homo sapiens GN=PI16 PE=1 SV=1 58 164 5.0E-10
sp|Q9CYL5|GAPR1_MOUSE Golgi-associated plant pathogenesis-related protein 1 OS=Mus musculus GN=Glipr2 PE=1 SV=3 36 169 7.0E-10
sp|Q58D34|PI16_BOVIN Peptidase inhibitor 16 OS=Bos taurus GN=PI16 PE=2 SV=1 58 164 2.0E-09
sp|Q9ET66|PI16_MOUSE Peptidase inhibitor 16 OS=Mus musculus GN=Pi16 PE=2 SV=1 58 164 3.0E-09
sp|Q9H4G4|GAPR1_HUMAN Golgi-associated plant pathogenesis-related protein 1 OS=Homo sapiens GN=GLIPR2 PE=1 SV=3 36 169 1.0E-08
sp|Q8JI38|CRVP_LATSE Cysteine-rich venom protein latisemin OS=Laticauda semifasciata PE=2 SV=1 58 166 6.0E-08
sp|B3A0P7|SCP1_LOTGI SCP domain-containing protein 1 OS=Lottia gigantea PE=1 SV=1 34 165 7.0E-08
sp|F8S0Y4|CRVP_CROAD Cysteine-rich secretory protein OS=Crotalus adamanteus PE=1 SV=1 87 164 8.0E-08
sp|P35794|SC7_SCHCO Fruiting body protein SC7 OS=Schizophyllum commune GN=SC7 PE=2 SV=1 50 161 1.0E-07
sp|Q2XXP1|CRVPB_VARVA Cysteine-rich venom protein VAR11 OS=Varanus varius PE=2 SV=1 56 164 1.0E-07
sp|Q2XXP2|CRVPA_VARVA Cysteine-rich venom protein VAR10 (Fragment) OS=Varanus varius PE=2 SV=1 56 164 1.0E-07
sp|Q32LB5|GPRL1_BOVIN GLIPR1-like protein 1 OS=Bos taurus GN=GLIPR1L1 PE=2 SV=1 87 160 1.0E-07
sp|Q7ZT99|CRVP_CROAT Cysteine-rich venom protein catrin OS=Crotalus atrox PE=1 SV=1 87 164 2.0E-07
sp|Q3SB03|CRVP_HOPST Cysteine-rich venom protein pseudechetoxin-like OS=Hoplocephalus stephensii PE=2 SV=1 20 166 2.0E-07
sp|P35781|VA51_VESCR Venom allergen 5.01 OS=Vespa crabro PE=1 SV=1 60 161 2.0E-07
sp|Q8AVA3|CRVP_PSEPO Cysteine-rich venom protein pseudecin OS=Pseudechis porphyriacus PE=1 SV=1 20 166 2.0E-07
sp|P35759|VA5_POLEX Venom allergen 5 OS=Polistes exclamans PE=1 SV=2 60 165 2.0E-07
sp|F7C0L1|CRISA_XENTR Allurin OS=Xenopus tropicalis GN=crisp-a PE=1 SV=2 77 161 2.0E-07
sp|Q6UWM5|GPRL1_HUMAN GLIPR1-like protein 1 OS=Homo sapiens GN=GLIPR1L1 PE=1 SV=2 87 161 2.0E-07
sp|Q3SB05|CRVP_PSETE Cysteine-rich venom protein pseudechetoxin-like OS=Pseudonaja textilis PE=1 SV=1 58 166 2.0E-07
sp|P35782|VA52_VESCR Venom allergen 5.02 OS=Vespa crabro PE=1 SV=1 60 161 3.0E-07
sp|Q7ZTA0|CRVP_AGKPI Cysteine-rich venom protein piscivorin OS=Agkistrodon piscivorus piscivorus PE=1 SV=1 83 165 3.0E-07
sp|Q8UW11|CRVP2_HYDHA Cysteine-rich venom protein 2 OS=Hydrophis hardwickii PE=2 SV=2 20 161 3.0E-07
sp|Q3SB06|CRVP_OXYMI Cysteine-rich venom protein pseudechetoxin-like OS=Oxyuranus microlepidotus PE=2 SV=1 20 166 4.0E-07
sp|Q3SB07|CRVP_OXYSC Cysteine-rich venom protein pseudechetoxin-like OS=Oxyuranus scutellatus scutellatus PE=2 SV=1 20 166 4.0E-07
sp|Q05109|VA5_POLAN Venom allergen 5 (Fragment) OS=Polistes annularis PE=1 SV=1 60 165 5.0E-07
sp|Q8AVA4|CRVP_PSEAU Cysteine-rich venom protein pseudechetoxin OS=Pseudechis australis PE=1 SV=1 6 166 6.0E-07
sp|Q3SB04|CRVP_NOTSC Cysteine-rich venom protein pseudechetoxin-like OS=Notechis scutatus scutatus PE=2 SV=1 20 166 7.0E-07
sp|A6MFK9|CRVP_DEMVE Cysteine-rich venom protein OS=Demansia vestigiata PE=2 SV=1 58 163 7.0E-07
sp|Q7ZT98|CRVP_OPHHA Cysteine-rich venom protein ophanin OS=Ophiophagus hannah PE=1 SV=1 83 163 7.0E-07
sp|P35795|SC14_SCHCO Fruiting body protein SC14 OS=Schizophyllum commune GN=SC14 PE=2 SV=1 4 161 7.0E-07
sp|Q7ZZN8|CRVP2_NAJAT Cysteine-rich venom protein natrin-2 OS=Naja atra PE=1 SV=1 58 165 9.0E-07
sp|P35778|VA3_SOLIN Venom allergen 3 OS=Solenopsis invicta PE=1 SV=2 58 163 1.0E-06
sp|P84808|CRVP2_NAJKA Cysteine-rich venom protein kaouthin-2 OS=Naja kaouthia PE=1 SV=2 58 165 1.0E-06
sp|P60623|CRVP_TRIST Cysteine-rich venom protein (Fragment) OS=Trimeresurus stejnegeri PE=1 SV=1 20 164 1.0E-06
sp|Q09GJ9|CRVP_PHIOL Cysteine-rich venom protein OS=Philodryas olfersii PE=2 SV=1 77 164 1.0E-06
sp|Q2XXQ5|CRVP2_DISTY Cysteine-rich venom protein DIS2 OS=Dispholidus typus PE=2 SV=1 20 163 1.0E-06
sp|F8J2D4|CRVP_DRYCN Cysteine-rich venom protein OS=Drysdalia coronoides PE=1 SV=1 58 166 2.0E-06
sp|A8S6B6|CRVP_AUSSU Cysteine-rich venom protein OS=Austrelaps superbus PE=2 SV=1 58 166 2.0E-06
sp|C0ITL3|VA5_PACCH Venom allergen 5 (Fragment) OS=Pachycondyla chinensis PE=2 SV=1 58 163 2.0E-06
sp|P16562|CRIS2_HUMAN Cysteine-rich secretory protein 2 OS=Homo sapiens GN=CRISP2 PE=1 SV=1 80 160 2.0E-06
sp|Q8JGT9|CRVP_RHATT Cysteine-rich venom protein tigrin OS=Rhabdophis tigrinus tigrinus PE=1 SV=1 20 163 2.0E-06
sp|Q2XXQ3|CRVP1_PSEPL Cysteine-rich venom protein ENH1 OS=Pseudoferania polylepis PE=2 SV=1 74 163 2.0E-06
sp|P35780|VA5_POLFU Venom allergen 5 OS=Polistes fuscatus PE=1 SV=1 60 165 2.0E-06
sp|Q2XXQ2|CRVP2_PSEPL Cysteine-rich venom protein ENH2 OS=Pseudoferania polylepis PE=2 SV=1 74 163 2.0E-06
sp|Q7Z156|VA5_POLSR Venom allergen 5 OS=Polybia scutellaris rioplatensis PE=1 SV=2 60 164 3.0E-06
sp|Q91055|CRVP_HELHO Cysteine-rich venom protein helothermine OS=Heloderma horridum horridum PE=1 SV=1 72 161 3.0E-06
sp|Q2XXR2|CRVP3_VARAC Cysteine-rich venom protein VAR3 (Fragment) OS=Varanus acanthurus PE=2 SV=1 101 164 3.0E-06
sp|Q2XXQ6|CRVP1_DISTY Cysteine-rich venom protein DIS1 OS=Dispholidus typus PE=2 SV=1 20 163 3.0E-06
sp|P81657|VA5_VESMA Venom allergen 5 OS=Vespa mandarinia PE=1 SV=1 60 161 3.0E-06
sp|P86870|VA5_VESMG Venom allergen 5 OS=Vespa magnifica PE=1 SV=2 60 161 3.0E-06
sp|Q2XXQ4|CRVP3_DISTY Cysteine-rich venom protein DIS3 OS=Dispholidus typus PE=2 SV=1 20 163 4.0E-06
sp|Q2XXQ7|CRVP8_VARAC Cysteine-rich venom protein VAR8 (Fragment) OS=Varanus acanthurus PE=2 SV=1 101 164 4.0E-06
sp|Q4V9Y5|CRLD2_XENTR Cysteine-rich secretory protein LCCL domain-containing 2 OS=Xenopus tropicalis GN=crispld2 PE=2 SV=1 86 171 5.0E-06
sp|Q09566|LON1_CAEEL Protein lon-1 OS=Caenorhabditis elegans GN=lon-1 PE=1 SV=1 56 160 5.0E-06
sp|Q2XXR0|CRVP5_VARAC Cysteine-rich venom protein VAR5 (Fragment) OS=Varanus acanthurus PE=2 SV=1 101 164 6.0E-06
sp|Q2XXP4|CRVP_TRIBI Cysteine-rich venom protein TRI1 (Fragment) OS=Trimorphodon biscutatus PE=2 SV=1 20 163 7.0E-06
sp|B7FDI1|CRVP_VIPBE Cysteine-rich venom protein OS=Vipera berus PE=1 SV=1 11 164 7.0E-06
sp|P86686|VA5_POLPI Venom allergen 5 OS=Polybia paulista PE=1 SV=1 60 163 9.0E-06
sp|P54108|CRIS3_HUMAN Cysteine-rich secretory protein 3 OS=Homo sapiens GN=CRISP3 PE=1 SV=1 58 160 1.0E-05
sp|Q03401|CRIS1_MOUSE Cysteine-rich secretory protein 1 OS=Mus musculus GN=Crisp1 PE=2 SV=1 35 165 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10041
MRTTALVLAAAALVQPTPAAAVVGDSPGNVWWLDQQAFQSSLLSTTDLFRSEHGAGLVRWNATLAAFAAWYVDGH
DCAFRHSGGPFGENLAYGYATPAATVAAWANERVLYDYGRPSYSPATGHFTQLVWRRTTDVGCARRWCGAQMQWL
LACEYWPRGNIYGQFGDNVGRRIR*
Coding >Hirsu2|10041
ATGAGGACGACGGCCCTCGTCCTGGCGGCGGCGGCCCTTGTGCAGCCGACGCCGGCGGCCGCGGTGGTCGGCGAC
TCGCCGGGCAACGTCTGGTGGCTGGACCAGCAGGCCTTCCAGTCGTCGCTCCTCAGCACGACGGACCTCTTCCGC
AGCGAGCACGGGGCCGGGCTGGTGCGGTGGAACGCGACGCTGGCGGCCTTCGCGGCCTGGTACGTCGACGGGCAC
GACTGCGCCTTCCGGCACTCGGGCGGGCCGTTCGGCGAGAACCTGGCCTACGGCTACGCGACGCCGGCCGCGACG
GTGGCAGCCTGGGCCAACGAGCGCGTCCTGTACGACTACGGCCGCCCGTCCTACTCGCCCGCCACCGGCCACTTC
ACCCAGCTGGTCTGGCGGCGCACGACGGACGTCGGCTGCGCCCGCCGCTGGTGCGGCGCCCAGATGCAGTGGCTG
CTCGCCTGCGAGTACTGGCCGCGCGGCAACATCTACGGCCAGTTCGGCGACAATGTCGGCAGGCGGATCCGATAG
Transcript >Hirsu2|10041
ATGAGGACGACGGCCCTCGTCCTGGCGGCGGCGGCCCTTGTGCAGCCGACGCCGGCGGCCGCGGTGGTCGGCGAC
TCGCCGGGCAACGTCTGGTGGCTGGACCAGCAGGCCTTCCAGTCGTCGCTCCTCAGCACGACGGACCTCTTCCGC
AGCGAGCACGGGGCCGGGCTGGTGCGGTGGAACGCGACGCTGGCGGCCTTCGCGGCCTGGTACGTCGACGGGCAC
GACTGCGCCTTCCGGCACTCGGGCGGGCCGTTCGGCGAGAACCTGGCCTACGGCTACGCGACGCCGGCCGCGACG
GTGGCAGCCTGGGCCAACGAGCGCGTCCTGTACGACTACGGCCGCCCGTCCTACTCGCCCGCCACCGGCCACTTC
ACCCAGCTGGTCTGGCGGCGCACGACGGACGTCGGCTGCGCCCGCCGCTGGTGCGGCGCCCAGATGCAGTGGCTG
CTCGCCTGCGAGTACTGGCCGCGCGGCAACATCTACGGCCAGTTCGGCGACAATGTCGGCAGGCGGATCCGATAG
Gene >Hirsu2|10041
ATGAGGACGACGGCCCTCGTCCTGGCGGCGGCGGCCCTTGTGCAGCCGACGCCGGCGGCCGCGGTGGTCGGCGAC
TCGCCGGGCAACGTCTGGTGGCTGGACCAGCAGGCCTTCCAGTCGTCGCTCCTCAGCACGACGGACCTCTTCCGC
AGCGAGCACGGGGCCGGGCTGGTGCGGTGGAACGCGACGCTGGCGGCCTTCGCGGCCTGGTACGTCGACGGGCAC
GACTGCGCCTTCCGGCACTCGGGCGGGCCGTTCGGCGAGAACCTGGCCTACGGCTACGCGACGCCGGCCGCGACG
GTGGCAGCCTGGGCCAACGAGCGCGTCCTGTACGACTACGGCCGCCCGTCCTACTCGCCCGCCACCGGCCACTTC
ACCCAGCTGGTCTGGCGGCGCACGACGGACGTCGGCTGCGCCCGCCGCTGGTGCGGCGCCCAGATGCAGTGGCTG
CTCGCCTGCGAGTACTGGCCGCGCGGCAACATCTACGGCCAGTTCGGCGACAATGTCGGCAGGCGGATCCGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail