Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10026
Gene name
LocationContig_777:7097..8336
Strand+
Gene length (bp)1239
Transcript length (bp)1047
Coding sequence length (bp)1047
Protein length (aa) 349

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00230 MIP Major intrinsic protein 1.6E-52 63 306

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A9Y006|AQP3_PIG Aquaporin-3 OS=Sus scrofa GN=AQP3 PE=2 SV=1 64 310 2.0E-60
sp|Q8R2N1|AQP3_MOUSE Aquaporin-3 OS=Mus musculus GN=Aqp3 PE=1 SV=1 64 310 3.0E-60
sp|Q08DE6|AQP3_BOVIN Aquaporin-3 OS=Bos taurus GN=AQP3 PE=2 SV=1 64 310 6.0E-60
sp|P47862|AQP3_RAT Aquaporin-3 OS=Rattus norvegicus GN=Aqp3 PE=2 SV=1 64 310 3.0E-59
sp|Q92482|AQP3_HUMAN Aquaporin-3 OS=Homo sapiens GN=AQP3 PE=2 SV=2 64 310 1.0E-58
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A9Y006|AQP3_PIG Aquaporin-3 OS=Sus scrofa GN=AQP3 PE=2 SV=1 64 310 2.0E-60
sp|Q8R2N1|AQP3_MOUSE Aquaporin-3 OS=Mus musculus GN=Aqp3 PE=1 SV=1 64 310 3.0E-60
sp|Q08DE6|AQP3_BOVIN Aquaporin-3 OS=Bos taurus GN=AQP3 PE=2 SV=1 64 310 6.0E-60
sp|P47862|AQP3_RAT Aquaporin-3 OS=Rattus norvegicus GN=Aqp3 PE=2 SV=1 64 310 3.0E-59
sp|Q92482|AQP3_HUMAN Aquaporin-3 OS=Homo sapiens GN=AQP3 PE=2 SV=2 64 310 1.0E-58
sp|O43315|AQP9_HUMAN Aquaporin-9 OS=Homo sapiens GN=AQP9 PE=2 SV=2 63 310 1.0E-57
sp|P43549|YFF4_YEAST Uncharacterized membrane protein YFL054C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YFL054C PE=1 SV=1 58 348 3.0E-56
sp|O14520|AQP7_HUMAN Aquaporin-7 OS=Homo sapiens GN=AQP7 PE=1 SV=1 62 310 1.0E-55
sp|Q4R691|AQP7_MACFA Aquaporin-7 OS=Macaca fascicularis GN=AQP7 PE=2 SV=1 62 310 5.0E-55
sp|P56627|AQP9_RAT Aquaporin-9 OS=Rattus norvegicus GN=Aqp9 PE=2 SV=1 66 318 4.0E-54
sp|P23900|FPS1_YEAST Glycerol uptake/efflux facilitator protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FPS1 PE=1 SV=2 57 318 4.0E-54
sp|Q9P7T9|YI7H_SCHPO Uncharacterized membrane protein C977.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.17 PE=3 SV=1 58 320 4.0E-52
sp|Q96PS8|AQP10_HUMAN Aquaporin-10 OS=Homo sapiens GN=AQP10 PE=2 SV=2 60 310 1.0E-51
sp|Q9JJJ3|AQP9_MOUSE Aquaporin-9 OS=Mus musculus GN=Aqp9 PE=2 SV=1 57 315 1.0E-51
sp|A6NL99|AQP73_HUMAN Putative aquaporin-7-like protein 3 OS=Homo sapiens GN=AQP7P3 PE=5 SV=2 62 310 2.0E-51
sp|O54794|AQP7_MOUSE Aquaporin-7 OS=Mus musculus GN=Aqp7 PE=1 SV=1 62 306 1.0E-49
sp|P56403|AQP7_RAT Aquaporin-7 OS=Rattus norvegicus GN=Aqp7 PE=1 SV=2 61 319 3.0E-49
sp|Q51389|GLPF_PSEAE Glycerol uptake facilitator protein OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=glpF PE=3 SV=2 63 310 9.0E-43
sp|P44826|GLPF_HAEIN Glycerol uptake facilitator protein OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=glpF PE=3 SV=1 62 319 6.0E-42
sp|P37451|PDUF_SALTY Propanediol diffusion facilitator OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pduF PE=2 SV=2 63 310 2.0E-36
sp|P31140|GLPF_SHIFL Glycerol uptake facilitator protein OS=Shigella flexneri GN=glpF PE=3 SV=2 60 310 1.0E-35
sp|P0AER0|GLPF_ECOLI Glycerol uptake facilitator protein OS=Escherichia coli (strain K12) GN=glpF PE=1 SV=1 60 310 2.0E-35
sp|P0AER1|GLPF_ECOL6 Glycerol uptake facilitator protein OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=glpF PE=3 SV=1 60 310 2.0E-35
sp|P0AER2|GLPF_ECO57 Glycerol uptake facilitator protein OS=Escherichia coli O157:H7 GN=glpF PE=3 SV=1 60 310 2.0E-35
sp|Q9X1E3|GLPF_THEMA Probable glycerol uptake facilitator protein OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=glpF PE=3 SV=1 69 307 4.0E-31
sp|P19255|GLPF_STRCO Probable glycerol uptake facilitator protein OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=glpF PE=2 SV=2 69 308 4.0E-28
sp|P18156|GLPF_BACSU Glycerol uptake facilitator protein OS=Bacillus subtilis (strain 168) GN=glpF PE=2 SV=2 71 307 1.0E-27
sp|P0A3Q8|GLPF_STRR6 Glycerol uptake facilitator protein OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=glpF PE=3 SV=1 64 309 2.0E-23
sp|P0A3Q7|GLPF_STRPN Glycerol uptake facilitator protein OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=glpF PE=3 SV=1 64 309 1.0E-22
sp|P47279|GLPF_MYCGE Probable glycerol uptake facilitator protein OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=glpF PE=3 SV=2 69 317 8.0E-22
sp|P22094|GLA_LACLC Glycerol facilitator-aquaporin gla OS=Lactococcus lactis subsp. cremoris GN=gla PE=1 SV=1 69 309 2.0E-21
sp|Q9CE02|GLA_LACLA Glycerol facilitator-aquaporin gla OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=gla PE=3 SV=1 69 309 3.0E-21
sp|P57392|GLPF_BUCAI Glycerol uptake facilitator protein OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=glpF PE=3 SV=1 62 310 1.0E-19
sp|Q9FIZ9|NIP41_ARATH Putative aquaporin NIP4-1 OS=Arabidopsis thaliana GN=NIP4-1 PE=3 SV=1 59 314 5.0E-18
sp|Q9ATM4|PIP27_MAIZE Aquaporin PIP2-7 OS=Zea mays GN=PIP2-7 PE=2 SV=1 19 315 3.0E-16
sp|Q651D5|PIP27_ORYSJ Probable aquaporin PIP2-7 OS=Oryza sativa subsp. japonica GN=PIP2-7 PE=2 SV=2 46 315 6.0E-16
sp|Q8K9M9|GLPF_BUCAP Glycerol uptake facilitator protein OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=glpF PE=3 SV=1 62 310 8.0E-16
sp|Q9C6T0|NIP31_ARATH Aquaporin NIP3-1 OS=Arabidopsis thaliana GN=NIP3-1 PE=2 SV=2 33 315 5.0E-15
sp|Q8W036|NIP42_ARATH Probable aquaporin NIP4-2 OS=Arabidopsis thaliana GN=NIP4-2 PE=2 SV=2 59 314 5.0E-15
sp|Q40746|NIP11_ORYSJ Aquaporin NIP1-1 OS=Oryza sativa subsp. japonica GN=NIP1-1 PE=2 SV=1 66 314 6.0E-15
sp|Q7Y1E6|PIP28_ORYSJ Probable aquaporin PIP2-8 OS=Oryza sativa subsp. japonica GN=PIP2-8 PE=2 SV=1 41 313 7.0E-15
sp|P75071|GLPF_MYCPN Probable glycerol uptake facilitator protein OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=glpF PE=3 SV=1 70 310 1.0E-14
sp|Q8LAI1|NIP71_ARATH Probable aquaporin NIP7-1 OS=Arabidopsis thaliana GN=NIP7-1 PE=2 SV=2 41 306 1.0E-14
sp|P55088|AQP4_MOUSE Aquaporin-4 OS=Mus musculus GN=Aqp4 PE=1 SV=2 62 307 4.0E-14
sp|P42767|PIP1_ATRCA Aquaporin PIP-type OS=Atriplex canescens PE=2 SV=1 41 307 5.0E-14
sp|Q8GRT8|PIP24_ORYSJ Aquaporin PIP2-4 OS=Oryza sativa subsp. japonica GN=PIP2-4 PE=2 SV=1 19 310 1.0E-13
sp|Q8VZW1|NIP11_ARATH Aquaporin NIP1-1 OS=Arabidopsis thaliana GN=NIP1-1 PE=1 SV=1 22 314 1.0E-13
sp|Q9ATN4|NIP11_MAIZE Aquaporin NIP1-1 OS=Zea mays GN=NIP1-1 PE=2 SV=1 66 271 2.0E-13
sp|P08995|NO26_SOYBN Nodulin-26 OS=Glycine max PE=1 SV=2 28 314 3.0E-13
sp|Q7XLR1|PIP26_ORYSJ Probable aquaporin PIP2-6 OS=Oryza sativa subsp. japonica GN=PIP2-6 PE=2 SV=2 28 310 4.0E-13
sp|Q9XF58|PIP25_MAIZE Aquaporin PIP2-5 OS=Zea mays GN=PIP2-5 PE=1 SV=1 28 319 1.0E-12
sp|P49173|NIP1_NICAL Probable aquaporin NIP-type OS=Nicotiana alata PE=2 SV=1 50 318 1.0E-12
sp|Q06019|MIP_LITPI Lens fiber major intrinsic protein OS=Lithobates pipiens PE=1 SV=1 63 311 1.0E-12
sp|Q5I4F9|AQP4_NOTAL Aquaporin-4 OS=Notomys alexis GN=AQP4 PE=2 SV=1 62 307 2.0E-12
sp|P43287|PIP22_ARATH Aquaporin PIP2-2 OS=Arabidopsis thaliana GN=PIP2-2 PE=1 SV=2 41 270 3.0E-12
sp|P47863|AQP4_RAT Aquaporin-4 OS=Rattus norvegicus GN=Aqp4 PE=1 SV=1 62 307 4.0E-12
sp|P25794|PIP2_PEA Probable aquaporin PIP-type 7a OS=Pisum sativum GN=TRG-31 PE=2 SV=2 32 310 4.0E-12
sp|Q9SAI4|NIP61_ARATH Aquaporin NIP6-1 OS=Arabidopsis thaliana GN=NIP6-1 PE=1 SV=1 63 308 4.0E-12
sp|Q7EYH7|NIP32_ORYSJ Aquaporin NIP3-2 OS=Oryza sativa subsp. japonica GN=NIP3-2 PE=2 SV=1 34 306 5.0E-12
sp|Q8LFP7|NIP12_ARATH Aquaporin NIP1-2 OS=Arabidopsis thaliana GN=NIP1-2 PE=2 SV=2 34 334 1.0E-11
sp|P30302|PIP23_ARATH Aquaporin PIP2-3 OS=Arabidopsis thaliana GN=PIP2-3 PE=1 SV=1 41 270 1.0E-11
sp|Q9ZVX8|PIP28_ARATH Probable aquaporin PIP2-8 OS=Arabidopsis thaliana GN=PIP2-8 PE=1 SV=1 41 310 2.0E-11
sp|Q9C4Z5|AQPM_METTM Aquaporin AqpM OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=aqpM PE=1 SV=4 63 301 2.0E-11
sp|Q41870|PIP11_MAIZE Aquaporin PIP1-1 OS=Zea mays GN=PIP1-1 PE=1 SV=1 18 310 2.0E-11
sp|Q7XSQ9|PIP12_ORYSJ Probable aquaporin PIP1-2 OS=Oryza sativa subsp. japonica GN=PIP1-2 PE=2 SV=3 41 310 2.0E-11
sp|Q9V5Z7|AQP_DROME Aquaporin OS=Drosophila melanogaster GN=Drip PE=2 SV=2 62 319 3.0E-11
sp|Q9ATM5|PIP26_MAIZE Aquaporin PIP2-6 OS=Zea mays GN=PIP2-6 PE=2 SV=1 27 299 3.0E-11
sp|Q923J4|AQP4_DIPME Aquaporin-4 OS=Dipodomys merriami GN=AQP4 PE=2 SV=1 62 329 4.0E-11
sp|Q9ATN1|NIP31_MAIZE Aquaporin NIP3-1 OS=Zea mays GN=NIP3-1 PE=2 SV=1 63 316 5.0E-11
sp|P34080|AQP2_RAT Aquaporin-2 OS=Rattus norvegicus GN=Aqp2 PE=1 SV=1 66 311 6.0E-11
sp|Q9FF53|PIP24_ARATH Probable aquaporin PIP2-4 OS=Arabidopsis thaliana GN=PIP2-4 PE=1 SV=1 41 310 7.0E-11
sp|P93004|PIP27_ARATH Aquaporin PIP2-7 OS=Arabidopsis thaliana GN=PIP2-7 PE=1 SV=2 24 310 8.0E-11
sp|Q06611|PIP12_ARATH Aquaporin PIP1-2 OS=Arabidopsis thaliana GN=PIP1-2 PE=1 SV=1 17 310 8.0E-11
sp|Q7XUA6|PIP23_ORYSJ Probable aquaporin PIP2-3 OS=Oryza sativa subsp. japonica GN=PIP2-3 PE=2 SV=1 41 319 1.0E-10
sp|Q6J8I9|MIP_SHEEP Lens fiber major intrinsic protein OS=Ovis aries GN=MIP PE=1 SV=1 63 339 1.0E-10
sp|P56402|AQP2_MOUSE Aquaporin-2 OS=Mus musculus GN=Aqp2 PE=1 SV=2 66 311 1.0E-10
sp|O86231|Y1017_HAEIN Uncharacterized aquaporin-like protein HI_1017 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1017 PE=3 SV=1 110 307 1.0E-10
sp|Q866S3|AQP5_SHEEP Aquaporin-5 OS=Ovis aries GN=AQP5 PE=2 SV=1 66 311 2.0E-10
sp|O77750|AQP4_BOVIN Aquaporin-4 OS=Bos taurus GN=AQP4 PE=2 SV=3 62 329 2.0E-10
sp|Q0IWF3|NIP31_ORYSJ Aquaporin NIP3-1 OS=Oryza sativa subsp. japonica GN=NIP3-1 PE=2 SV=2 63 316 2.0E-10
sp|Q9WTY4|AQP5_MOUSE Aquaporin-5 OS=Mus musculus GN=Aqp5 PE=1 SV=1 63 339 2.0E-10
sp|P55064|AQP5_HUMAN Aquaporin-5 OS=Homo sapiens GN=AQP5 PE=1 SV=1 66 311 3.0E-10
sp|Q7W917|AQPZ_BORPA Aquaporin Z OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=aqpZ PE=3 SV=1 61 308 3.0E-10
sp|Q7WKG2|AQPZ_BORBR Aquaporin Z OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=aqpZ PE=3 SV=1 61 308 3.0E-10
sp|Q9AQU5|PIP13_MAIZE Aquaporin PIP1-3/PIP1-4 OS=Zea mays GN=PIP1-3 PE=2 SV=1 41 310 3.0E-10
sp|P55087|AQP4_HUMAN Aquaporin-4 OS=Homo sapiens GN=AQP4 PE=1 SV=2 62 307 3.0E-10
sp|A8W649|AQP5_PIG Aquaporin-5 OS=Sus scrofa GN=AQP5 PE=2 SV=1 63 311 4.0E-10
sp|Q6EU94|PIP11_ORYSJ Aquaporin PIP1-1 OS=Oryza sativa subsp. japonica GN=PIP1-1 PE=2 SV=1 41 310 5.0E-10
sp|A2IBY8|MIP_CANLF Lens fiber major intrinsic protein OS=Canis lupus familiaris GN=MIP PE=2 SV=1 63 311 6.0E-10
sp|Q9XF59|PIP12_MAIZE Aquaporin PIP1-2 OS=Zea mays GN=PIP1-2 PE=1 SV=1 41 310 9.0E-10
sp|P51180|MIP_MOUSE Lens fiber major intrinsic protein OS=Mus musculus GN=Mip PE=1 SV=2 63 311 2.0E-09
sp|Q6K215|PIP22_ORYSJ Probable aquaporin PIP2-2 OS=Oryza sativa subsp. japonica GN=PIP2-2 PE=2 SV=1 27 270 2.0E-09
sp|Q0DK16|NIP13_ORYSJ Aquaporin NIP1-3 OS=Oryza sativa subsp. japonica GN=NIP1-3 PE=3 SV=2 66 332 3.0E-09
sp|Q8H5N9|PIP21_ORYSJ Probable aquaporin PIP2-1 OS=Oryza sativa subsp. japonica GN=PIP2-1 PE=2 SV=1 41 298 3.0E-09
sp|P09011|MIP_RAT Lens fiber major intrinsic protein (Fragment) OS=Rattus norvegicus GN=Mip PE=1 SV=2 63 311 3.0E-09
sp|P47864|AQP5_RAT Aquaporin-5 OS=Rattus norvegicus GN=Aqp5 PE=2 SV=1 63 339 3.0E-09
sp|A4L9J0|MIP_RABIT Lens fiber major intrinsic protein OS=Oryctolagus cuniculus GN=MIP PE=2 SV=1 63 311 4.0E-09
sp|Q19KC1|NIP21_MAIZE Aquaporin NIP2-1 OS=Zea mays GN=NIP2-1 PE=2 SV=2 35 332 4.0E-09
sp|Q7PWV1|AQP_ANOGA Aquaporin AQPAn.G OS=Anopheles gambiae GN=AGAP008842 PE=3 SV=4 62 319 4.0E-09
sp|Q9ATM7|PIP23_MAIZE Aquaporin PIP2-3 OS=Zea mays GN=PIP2-3 PE=2 SV=1 27 319 4.0E-09
sp|P30301|MIP_HUMAN Lens fiber major intrinsic protein OS=Homo sapiens GN=MIP PE=1 SV=1 63 311 4.0E-09
sp|Q9ATM6|PIP24_MAIZE Aquaporin PIP2-4 OS=Zea mays GN=PIP2-4 PE=1 SV=1 27 319 5.0E-09
sp|Q9ZV07|PIP26_ARATH Probable aquaporin PIP2-6 OS=Arabidopsis thaliana GN=PIP2-6 PE=1 SV=1 29 310 6.0E-09
sp|P41181|AQP2_HUMAN Aquaporin-2 OS=Homo sapiens GN=AQP2 PE=1 SV=1 66 311 9.0E-09
sp|O26206|AQPM_METTH Aquaporin AqpM OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=aqpM PE=3 SV=1 63 301 9.0E-09
sp|Q9SV84|NIP51_ARATH Probable aquaporin NIP5-1 OS=Arabidopsis thaliana GN=NIP5-1 PE=2 SV=1 63 306 1.0E-08
sp|P52280|GLPF_MYCGA Probable glycerol uptake facilitator protein OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=glpF PE=3 SV=2 71 273 1.0E-08
sp|Q0JPT5|NIP12_ORYSJ Aquaporin NIP1-2 OS=Oryza sativa subsp. japonica GN=NIP1-2 PE=2 SV=2 69 314 1.0E-08
sp|Q9SV31|PIP25_ARATH Probable aquaporin PIP2-5 OS=Arabidopsis thaliana GN=PIP2-5 PE=1 SV=1 41 310 1.0E-08
sp|Q9ATN0|PIP16_MAIZE Aquaporin PIP1-6 OS=Zea mays GN=PIP1-6 PE=2 SV=1 33 299 2.0E-08
sp|Q9ATM8|PIP22_MAIZE Aquaporin PIP2-2 OS=Zea mays GN=PIP2-2 PE=2 SV=1 27 270 2.0E-08
sp|Q25074|AQP_HAEIX Aquaporin OS=Haematobia irritans exigua PE=2 SV=1 62 319 3.0E-08
sp|Q9AR14|PIP15_MAIZE Aquaporin PIP1-5 OS=Zea mays GN=PIP1-5 PE=2 SV=1 41 310 3.0E-08
sp|O28846|AQPM_ARCFU Probable aquaporin AqpM OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=aqpM PE=1 SV=1 70 307 4.0E-08
sp|Q6Z2T3|NIP21_ORYSJ Aquaporin NIP2-1 OS=Oryza sativa subsp. japonica GN=NIP2-1 PE=1 SV=1 64 332 4.0E-08
sp|Q9SXF8|PIP13_ORYSJ Aquaporin PIP 1-3 OS=Oryza sativa subsp. japonica GN=PIP1-3 PE=2 SV=2 41 310 5.0E-08
sp|Q02013|AQP1_MOUSE Aquaporin-1 OS=Mus musculus GN=Aqp1 PE=1 SV=3 60 339 5.0E-08
sp|P47865|AQP1_BOVIN Aquaporin-1 OS=Bos taurus GN=AQP1 PE=1 SV=3 60 310 5.0E-08
sp|P79099|AQP2_BOVIN Aquaporin-2 OS=Bos taurus GN=AQP2 PE=2 SV=2 66 311 6.0E-08
sp|Q9ATN2|NIP22_MAIZE Aquaporin NIP2-2 OS=Zea mays GN=NIP2-2 PE=2 SV=1 64 332 7.0E-08
sp|P61838|PIP11_VICFA Aquaporin PIP1.1 OS=Vicia faba GN=PIP1.1 PE=2 SV=1 63 310 7.0E-08
sp|P61837|PIP11_ARATH Aquaporin PIP1-1 OS=Arabidopsis thaliana GN=PIP1-1 PE=1 SV=1 63 310 7.0E-08
sp|P29975|AQP1_RAT Aquaporin-1 OS=Rattus norvegicus GN=Aqp1 PE=1 SV=4 60 339 8.0E-08
sp|Q88F17|AQPZ_PSEPK Aquaporin Z OS=Pseudomonas putida (strain KT2440) GN=aqpZ PE=3 SV=1 63 306 9.0E-08
sp|Q13520|AQP6_HUMAN Aquaporin-6 OS=Homo sapiens GN=AQP6 PE=2 SV=2 62 311 9.0E-08
sp|Q84S07|NIP33_ORYSJ Aquaporin NIP3-3 OS=Oryza sativa subsp. japonica GN=NIP3-3 PE=2 SV=1 31 306 1.0E-07
sp|Q9NHW7|AQP_AEDAE Aquaporin AQPAe.a OS=Aedes aegypti GN=AAEL003512 PE=2 SV=2 62 309 2.0E-07
sp|Q54WT8|AQPB_DICDI Aquaporin-B OS=Dictyostelium discoideum GN=aqpB PE=1 SV=1 28 222 4.0E-07
sp|Q9AT74|NIP23_MAIZE Aquaporin NIP2-3 OS=Zea mays GN=NIP2-3 PE=2 SV=1 64 332 5.0E-07
sp|P50501|AQPA_PELES Aquaporin FA-CHIP OS=Pelophylax esculentus GN=AQPA PE=2 SV=1 60 344 7.0E-07
sp|Q9N2J4|AQP1_CANLF Aquaporin-1 OS=Canis lupus familiaris GN=AQP1 PE=2 SV=3 60 310 1.0E-06
sp|Q08733|PIP13_ARATH Aquaporin PIP1-3 OS=Arabidopsis thaliana GN=PIP1-3 PE=1 SV=1 63 310 1.0E-06
sp|P79200|AQP2_ORYAF Aquaporin-2 (Fragment) OS=Orycteropus afer GN=AQP2 PE=3 SV=1 66 162 2.0E-06
sp|Q9WTY0|AQP6_RAT Aquaporin-6 OS=Rattus norvegicus GN=Aqp6 PE=1 SV=1 69 311 2.0E-06
sp|Q5Z9E2|NIP14_ORYSJ Aquaporin NIP1-4 OS=Oryza sativa subsp. japonica GN=NIP1-4 PE=2 SV=1 7 314 2.0E-06
sp|P79213|AQP2_RABIT Aquaporin-2 (Fragment) OS=Oryctolagus cuniculus GN=AQP2 PE=3 SV=1 66 162 3.0E-06
sp|P23645|BIB_DROME Neurogenic protein big brain OS=Drosophila melanogaster GN=bib PE=1 SV=2 120 348 3.0E-06
sp|Q8LAA6|PIP15_ARATH Probable aquaporin PIP1-5 OS=Arabidopsis thaliana GN=PIP1-5 PE=2 SV=2 63 310 3.0E-06
sp|P79803|AQP2_MACPR Aquaporin-2 (Fragment) OS=Macroscelides proboscideus GN=AQP2 PE=3 SV=1 66 162 3.0E-06
sp|P29972|AQP1_HUMAN Aquaporin-1 OS=Homo sapiens GN=AQP1 PE=1 SV=3 60 310 3.0E-06
sp|Q23808|AQP_CICVR Aquaporin AQPcic OS=Cicadella viridis GN=AQP PE=1 SV=1 62 306 3.0E-06
sp|O62735|AQP2_SHEEP Aquaporin-2 OS=Ovis aries GN=AQP2 PE=2 SV=1 66 311 3.0E-06
sp|Q7NNP3|AQPZ_GLOVI Aquaporin Z OS=Gloeobacter violaceus (strain PCC 7421) GN=aqpZ PE=3 SV=1 63 320 3.0E-06
sp|P79144|AQP2_CANLF Aquaporin-2 (Fragment) OS=Canis lupus familiaris GN=AQP2 PE=3 SV=1 66 162 4.0E-06
sp|O77740|AQP2_TALEU Aquaporin-2 (Fragment) OS=Talpa europaea GN=AQP2 PE=3 SV=1 66 162 4.0E-06
sp|P79168|AQP2_ELEMA Aquaporin-2 (Fragment) OS=Elephas maximus GN=AQP2 PE=3 SV=1 66 162 7.0E-06
sp|O77722|AQP2_ERIEU Aquaporin-2 (Fragment) OS=Erinaceus europaeus GN=AQP2 PE=3 SV=1 66 162 9.0E-06
sp|Q8FY85|AQPZ_BRUSU Aquaporin Z OS=Brucella suis biovar 1 (strain 1330) GN=aqpZ PE=3 SV=1 70 175 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0015267 channel activity Yes
GO:0055085 transmembrane transport Yes
GO:0016020 membrane Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0022803 passive transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0051179 localization No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 61 0.45

Transmembrane Domains

Domain # Start End Length
1 72 94 22
2 101 118 17
3 143 165 22
4 203 225 22
5 240 262 22
6 283 305 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10026
MPPSPPRQESVYESSVDNKPVDKSATVDMSSATKHEDPVLDASNAPPTPEEEPHQLRWPKIRSLWQDAFSEFFGT
MILILFGDGVVAQVLLSNNTKGDYQSISWGWGIGVMLGVYVGGKSGGHINPAVTLANCVFKGHPWRKFPVYALAQ
LLGAMVGAAIVYGNYKSAIDNFEGGRGIRTVSGPNATAGIFCTYPAAFMTRTGMFFSEFIASAILQFVIFALTDP
DNIGAGPSPLLPLCLFFLIFGIGACFGWETGYAINLARDFGPRLVSYMIGYGHEVWSFGGYYFWIPMVAPFLGCL
SGGALYDLFIYTGESPMNSPWLGLNRLFKPRRGSWSNGRGKTHHQSSV*
Coding >Hirsu2|10026
ATGCCCCCGTCCCCGCCTCGCCAGGAGTCCGTGTACGAGTCGTCGGTCGACAACAAGCCCGTCGACAAGTCGGCT
ACCGTGGACATGAGCAGCGCCACCAAGCACGAGGATCCGGTCCTGGATGCCTCCAACGCGCCCCCGACGCCCGAG
GAGGAGCCGCACCAGCTGCGGTGGCCCAAGATCCGCTCCCTCTGGCAGGATGCCTTCTCCGAGTTCTTCGGCACC
ATGATCCTCATCCTCTTCGGCGACGGCGTCGTCGCCCAGGTCTTGCTGAGCAACAACACCAAGGGCGACTACCAG
AGCATTTCCTGGGGCTGGGGCATCGGCGTCATGCTCGGCGTCTACGTCGGCGGCAAGTCCGGCGGGCACATCAAC
CCGGCCGTGACTCTGGCCAACTGCGTCTTCAAGGGCCACCCCTGGCGCAAGTTCCCCGTCTACGCCCTCGCTCAG
CTCCTGGGCGCCATGGTCGGAGCTGCCATTGTCTATGGCAACTACAAGTCGGCCATTGACAATTTCGAGGGCGGC
CGCGGCATTCGCACCGTCAGCGGCCCCAACGCCACGGCCGGCATCTTCTGCACCTACCCCGCAGCCTTCATGACG
CGGACCGGCATGTTCTTTTCCGAGTTCATCGCCAGCGCCATCCTGCAGTTTGTCATCTTCGCCCTGACGGACCCG
GACAACATTGGCGCCGGCCCCAGCCCGCTGCTGCCTCTGTGCCTGTTCTTCCTCATCTTCGGCATTGGTGCTTGC
TTCGGCTGGGAGACGGGCTATGCCATCAACCTCGCCCGTGATTTCGGGCCTCGCTTGGTCTCGTACATGATCGGC
TATGGACACGAGGTCTGGTCGTTCGGCGGCTATTATTTCTGGATACCCATGGTCGCTCCCTTCCTCGGCTGCTTG
TCGGGCGGCGCGCTGTATGACTTGTTCATTTACACGGGCGAGTCGCCCATGAACTCGCCGTGGCTCGGACTCAAC
CGACTCTTCAAGCCGAGGCGTGGCTCCTGGTCCAACGGCAGAGGCAAGACGCACCACCAGTCCAGCGTGTAG
Transcript >Hirsu2|10026
ATGCCCCCGTCCCCGCCTCGCCAGGAGTCCGTGTACGAGTCGTCGGTCGACAACAAGCCCGTCGACAAGTCGGCT
ACCGTGGACATGAGCAGCGCCACCAAGCACGAGGATCCGGTCCTGGATGCCTCCAACGCGCCCCCGACGCCCGAG
GAGGAGCCGCACCAGCTGCGGTGGCCCAAGATCCGCTCCCTCTGGCAGGATGCCTTCTCCGAGTTCTTCGGCACC
ATGATCCTCATCCTCTTCGGCGACGGCGTCGTCGCCCAGGTCTTGCTGAGCAACAACACCAAGGGCGACTACCAG
AGCATTTCCTGGGGCTGGGGCATCGGCGTCATGCTCGGCGTCTACGTCGGCGGCAAGTCCGGCGGGCACATCAAC
CCGGCCGTGACTCTGGCCAACTGCGTCTTCAAGGGCCACCCCTGGCGCAAGTTCCCCGTCTACGCCCTCGCTCAG
CTCCTGGGCGCCATGGTCGGAGCTGCCATTGTCTATGGCAACTACAAGTCGGCCATTGACAATTTCGAGGGCGGC
CGCGGCATTCGCACCGTCAGCGGCCCCAACGCCACGGCCGGCATCTTCTGCACCTACCCCGCAGCCTTCATGACG
CGGACCGGCATGTTCTTTTCCGAGTTCATCGCCAGCGCCATCCTGCAGTTTGTCATCTTCGCCCTGACGGACCCG
GACAACATTGGCGCCGGCCCCAGCCCGCTGCTGCCTCTGTGCCTGTTCTTCCTCATCTTCGGCATTGGTGCTTGC
TTCGGCTGGGAGACGGGCTATGCCATCAACCTCGCCCGTGATTTCGGGCCTCGCTTGGTCTCGTACATGATCGGC
TATGGACACGAGGTCTGGTCGTTCGGCGGCTATTATTTCTGGATACCCATGGTCGCTCCCTTCCTCGGCTGCTTG
TCGGGCGGCGCGCTGTATGACTTGTTCATTTACACGGGCGAGTCGCCCATGAACTCGCCGTGGCTCGGACTCAAC
CGACTCTTCAAGCCGAGGCGTGGCTCCTGGTCCAACGGCAGAGGCAAGACGCACCACCAGTCCAGCGTGTAG
Gene >Hirsu2|10026
ATGCCCCCGTCCCCGCCTCGCCAGGAGTCCGTGTACGAGTCGTCGGTCGACAACAAGCCCGTCGACAAGTCGGCT
ACCGTGGACATGAGCAGCGCCACCAAGCACGAGGATCCGGTCCTGGATGCCTCCAACGCGCCCCCGACGCCCGAG
GAGGAGCCGCACCAGCTGCGGTGGCCCAAGATCCGCTCCCTCTGGCAGGATGCCTTCTCCGAGTTCTTCGGCACC
ATGATCCTCATCCTCTTCGGCGACGGCGTCGTCGCCCAGGTCTTGCTGAGCAACAACACCAAGGGCGACTACCAG
AGCATTTCCTGGGGCTGGGGGTAAGCAACCAGGCCGTCCCGCCCCCTCCTCCCGCCTGCGGGTGAGCACGGGCTA
TCTTGTTGCCGCTGTCGCTGACTTCCCTTCTTCCCCCCCCCGCAGCATCGGCGTCATGCTCGGCGTCTACGTCGG
CGGCAAGTCCGGCGGGCACATCAACCCGGCCGTGACTCTGGCCAACTGCGTCTTCAAGGGCCACCCCTGGCGCAA
GTTCCCCGTCTACGCCCTCGCTCAGCTCCTGGGCGCCATGGTCGGAGCTGCCATTGTCTATGGCAACTACAAGTC
GGCCATTGACAATTTCGAGGGCGGCCGCGGCATTCGCACCGTCAGCGGCCCCAACGCCACGGCCGGCATCTTCTG
CACCTACCCCGCAGCCTTCATGACGCGGACCGGCATGTTCTTTTCCGAGTTCATCGCCAGCGCCATCCTGCAGTT
TGTCATCTTCGCCCTGACGGACCCGGACAACATTGGCGCCGGCCCCAGCCCGCTGCTGCCTCTGTGCCTGTTCTT
CCTCATCTTCGGCATTGGTGCTTGCTTCGGCTGGGAGACGGGCTATGCCATCAACCTCGCCCGTGATTTCGGGCC
TCGCTTGGTCTCGTACATGATCGGCTATGGACACGAGGTCTGGTCGTTCGGCGGCTATTATTTCTGGGTGAGTCC
GAGTCCAGGTCCGGGTCCGGGTTCGGGTCCGAGTCCGGCCCGCTCGCCAAGTAACCACCCCCGGCTGACGGCGCA
ACATGACAGATACCCATGGTCGCTCCCTTCCTCGGCTGCTTGTCGGGCGGCGCGCTGTATGACTTGTTCATTTAC
ACGGGCGAGTCGCCCATGAACTCGCCGTGGCTCGGACTCAACCGACTCTTCAAGCCGAGGCGTGGCTCCTGGTCC
AACGGCAGAGGCAAGACGCACCACCAGTCCAGCGTGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail