Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10024
Gene name
LocationContig_777:1873..3366
Strand-
Gene length (bp)1493
Transcript length (bp)1431
Coding sequence length (bp)1431
Protein length (aa) 477

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02782 FGGY_C FGGY family of carbohydrate kinases, C-terminal domain 6.6E-72 237 428
PF00370 FGGY_N FGGY family of carbohydrate kinases, N-terminal domain 1.4E-50 7 228

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B9LD34|GLPK_CHLSY Glycerol kinase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=glpK PE=3 SV=1 12 474 2.0E-143
sp|A5CS23|GLPK_CLAM3 Glycerol kinase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=glpK PE=3 SV=1 12 476 9.0E-143
sp|B8GC51|GLPK_CHLAD Glycerol kinase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=glpK PE=3 SV=1 12 474 1.0E-142
sp|A9WJ21|GLPK_CHLAA Glycerol kinase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=glpK PE=3 SV=1 12 474 3.0E-142
sp|Q63060|GLPK_RAT Glycerol kinase OS=Rattus norvegicus GN=Gk PE=2 SV=1 10 474 1.0E-140
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B9LD34|GLPK_CHLSY Glycerol kinase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=glpK PE=3 SV=1 12 474 2.0E-143
sp|A5CS23|GLPK_CLAM3 Glycerol kinase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=glpK PE=3 SV=1 12 476 9.0E-143
sp|B8GC51|GLPK_CHLAD Glycerol kinase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=glpK PE=3 SV=1 12 474 1.0E-142
sp|A9WJ21|GLPK_CHLAA Glycerol kinase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=glpK PE=3 SV=1 12 474 3.0E-142
sp|Q63060|GLPK_RAT Glycerol kinase OS=Rattus norvegicus GN=Gk PE=2 SV=1 10 474 1.0E-140
sp|A1R6X6|GLPK_ARTAT Glycerol kinase OS=Arthrobacter aurescens (strain TC1) GN=glpK PE=3 SV=1 12 476 2.0E-139
sp|Q64516|GLPK_MOUSE Glycerol kinase OS=Mus musculus GN=Gk PE=1 SV=2 10 475 2.0E-139
sp|Q0IID9|GLPK_BOVIN Glycerol kinase OS=Bos taurus GN=GK PE=2 SV=1 10 475 7.0E-139
sp|A5UU55|GLPK_ROSS1 Glycerol kinase OS=Roseiflexus sp. (strain RS-1) GN=glpK PE=3 SV=1 12 476 8.0E-139
sp|P9WPK1|GLPK_MYCTU Glycerol kinase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=glpK PE=1 SV=1 12 476 1.0E-138
sp|P9WPK0|GLPK_MYCTO Glycerol kinase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=glpK PE=3 SV=1 12 476 1.0E-138
sp|A5U920|GLPK_MYCTA Glycerol kinase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=glpK PE=3 SV=1 12 476 1.0E-138
sp|C5C1C4|GLPK_BEUC1 Glycerol kinase OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=glpK PE=3 SV=1 12 476 1.0E-138
sp|Q6AGR0|GLPK_LEIXX Glycerol kinase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=glpK PE=3 SV=1 12 476 1.0E-138
sp|B8H8T1|GLPK_ARTCA Glycerol kinase OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=glpK PE=3 SV=1 12 476 2.0E-138
sp|Q14409|GLPK3_HUMAN Putative glycerol kinase 3 OS=Homo sapiens GN=GK3P PE=5 SV=2 10 475 2.0E-138
sp|Q4R4D5|GLPK2_MACFA Glycerol kinase 2 OS=Macaca fascicularis GN=GK2 PE=2 SV=1 10 475 3.0E-138
sp|A6WXV2|GLPK_OCHA4 Glycerol kinase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=glpK PE=3 SV=1 3 474 5.0E-138
sp|Q01V13|GLPK_SOLUE Glycerol kinase OS=Solibacter usitatus (strain Ellin6076) GN=glpK PE=3 SV=1 12 474 6.0E-138
sp|Q54VT8|GLPK_DICDI Probable glycerol kinase OS=Dictyostelium discoideum GN=gk PE=3 SV=1 12 476 6.0E-138
sp|Q14410|GLPK2_HUMAN Glycerol kinase 2 OS=Homo sapiens GN=GK2 PE=2 SV=2 10 475 1.0E-137
sp|P32189|GLPK_HUMAN Glycerol kinase OS=Homo sapiens GN=GK PE=1 SV=3 10 475 9.0E-137
sp|A5VE44|GLPK_SPHWW Glycerol kinase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=glpK PE=3 SV=1 12 476 1.0E-136
sp|A4FNR2|GLPK_SACEN Glycerol kinase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=glpK PE=3 SV=1 12 474 1.0E-136
sp|A9WS93|GLPK_RENSM Glycerol kinase OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=glpK PE=3 SV=1 12 476 1.0E-136
sp|Q9WU65|GLPK2_MOUSE Glycerol kinase 2 OS=Mus musculus GN=Gk2 PE=1 SV=1 10 475 2.0E-134
sp|B2IE09|GLPK_BEII9 Glycerol kinase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=glpK PE=3 SV=1 12 474 3.0E-134
sp|Q9CB81|GLPK_MYCLE Glycerol kinase OS=Mycobacterium leprae (strain TN) GN=glpK PE=3 SV=1 12 476 1.0E-133
sp|A5G146|GLPK_ACICJ Glycerol kinase OS=Acidiphilium cryptum (strain JF-5) GN=glpK PE=3 SV=1 12 476 2.0E-133
sp|Q9RJM2|GLPK1_STRCO Glycerol kinase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=glpK1 PE=3 SV=1 12 474 1.0E-132
sp|Q826J2|GLPK3_STRAW Glycerol kinase 3 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=glpK3 PE=3 SV=1 12 475 1.0E-132
sp|Q827G1|GLPK2_STRAW Glycerol kinase 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=glpK2 PE=3 SV=1 12 474 4.0E-132
sp|Q39V17|GLPK_GEOMG Glycerol kinase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=glpK PE=3 SV=1 12 475 5.0E-132
sp|B1ZGW7|GLPK_METPB Glycerol kinase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=glpK PE=3 SV=1 4 474 1.0E-130
sp|A8I8V7|GLPK_AZOC5 Glycerol kinase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=glpK PE=3 SV=1 12 475 4.0E-130
sp|Q47ER3|GLPK_DECAR Glycerol kinase OS=Dechloromonas aromatica (strain RCB) GN=glpK PE=3 SV=1 12 476 5.0E-130
sp|B7KN92|GLPK_METC4 Glycerol kinase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=glpK PE=3 SV=1 3 474 8.0E-130
sp|A9W8T7|GLPK_METEP Glycerol kinase OS=Methylobacterium extorquens (strain PA1) GN=glpK PE=3 SV=1 3 474 5.0E-129
sp|B3E6Z6|GLPK_GEOLS Glycerol kinase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=glpK PE=3 SV=1 14 476 6.0E-129
sp|Q9M8L4|GLPK_ARATH Glycerol kinase OS=Arabidopsis thaliana GN=GLPK PE=1 SV=1 12 469 2.0E-128
sp|A1TGD7|GLPK_MYCVP Glycerol kinase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=glpK PE=3 SV=1 12 476 6.0E-128
sp|B1LWN6|GLPK_METRJ Glycerol kinase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=glpK PE=3 SV=1 14 474 2.0E-127
sp|Q9ADA7|GLPK2_STRCO Glycerol kinase 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=glpK2 PE=3 SV=1 12 474 1.0E-126
sp|Q828K5|GLPK1_STRAW Glycerol kinase 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=glpK1 PE=3 SV=1 12 474 2.0E-126
sp|B1MFT1|GLPK_MYCA9 Glycerol kinase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=glpK PE=3 SV=1 12 469 4.0E-126
sp|A4T5Y1|GLPK_MYCGI Glycerol kinase OS=Mycobacterium gilvum (strain PYR-GCK) GN=glpK PE=3 SV=1 12 476 5.0E-126
sp|Q9X1E4|GLPK2_THEMA Glycerol kinase 2 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=glpK2 PE=3 SV=2 12 474 5.0E-126
sp|Q5Z175|GLPK_NOCFA Glycerol kinase OS=Nocardia farcinica (strain IFM 10152) GN=glpK PE=3 SV=1 12 474 2.0E-125
sp|Q9RT38|GLPK_DEIRA Glycerol kinase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=glpK PE=3 SV=1 12 476 2.0E-125
sp|Q749I1|GLPK_GEOSL Glycerol kinase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=glpK PE=3 SV=1 14 476 2.0E-124
sp|Q3AB25|GLPK_CARHZ Glycerol kinase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=glpK PE=3 SV=1 12 474 2.0E-124
sp|A1W309|GLPK_ACISJ Glycerol kinase OS=Acidovorax sp. (strain JS42) GN=glpK PE=3 SV=1 12 468 3.0E-124
sp|Q8ENK7|GLPK_OCEIH Glycerol kinase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=glpK PE=3 SV=1 12 472 4.0E-124
sp|Q1IMB2|GLPK_KORVE Glycerol kinase OS=Koribacter versatilis (strain Ellin345) GN=glpK PE=3 SV=1 12 474 4.0E-124
sp|A5VZG7|GLPK_PSEP1 Glycerol kinase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=glpK PE=3 SV=1 12 476 4.0E-124
sp|Q8NLP9|GLPK_CORGL Glycerol kinase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=glpK PE=3 SV=1 12 471 5.0E-124
sp|A4QHT1|GLPK_CORGB Glycerol kinase OS=Corynebacterium glutamicum (strain R) GN=glpK PE=3 SV=1 12 471 5.0E-124
sp|C4LGQ3|GLPK_CORK4 Glycerol kinase OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=glpK PE=3 SV=1 12 474 6.0E-124
sp|Q88NX8|GLPK_PSEPK Glycerol kinase OS=Pseudomonas putida (strain KT2440) GN=glpK PE=3 SV=1 12 476 1.0E-123
sp|B0KUG0|GLPK_PSEPG Glycerol kinase OS=Pseudomonas putida (strain GB-1) GN=glpK PE=3 SV=1 12 476 1.0E-123
sp|A4G1Q7|GLPK_HERAR Glycerol kinase OS=Herminiimonas arsenicoxydans GN=glpK PE=3 SV=1 12 474 1.0E-123
sp|Q1IE16|GLPK_PSEE4 Glycerol kinase OS=Pseudomonas entomophila (strain L48) GN=glpK PE=3 SV=1 12 476 2.0E-123
sp|Q8FLY8|GLPK_COREF Glycerol kinase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=glpK PE=3 SV=2 12 468 4.0E-123
sp|A5EWH1|GLPK_DICNV Glycerol kinase OS=Dichelobacter nodosus (strain VCS1703A) GN=glpK PE=3 SV=1 12 474 8.0E-123
sp|A9BJ81|GLPK_PETMO Glycerol kinase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=glpK PE=3 SV=1 12 474 9.0E-123
sp|B8FXS7|GLPK_DESHD Glycerol kinase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=glpK PE=3 SV=1 12 469 1.0E-122
sp|Q4ZPI7|GLPK_PSEU2 Glycerol kinase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=glpK PE=3 SV=1 12 474 2.0E-122
sp|A0KAA1|GLPK_BURCH Glycerol kinase OS=Burkholderia cenocepacia (strain HI2424) GN=glpK PE=3 SV=1 12 476 2.0E-122
sp|B1JY43|GLPK_BURCC Glycerol kinase OS=Burkholderia cenocepacia (strain MC0-3) GN=glpK PE=3 SV=1 12 476 2.0E-122
sp|Q1BTT7|GLPK_BURCA Glycerol kinase OS=Burkholderia cenocepacia (strain AU 1054) GN=glpK PE=3 SV=1 12 476 2.0E-122
sp|Q87XL0|GLPK_PSESM Glycerol kinase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=glpK PE=3 SV=1 12 474 3.0E-122
sp|A6LCZ1|GLPK_PARD8 Glycerol kinase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=glpK PE=3 SV=1 12 475 3.0E-122
sp|A6SUL1|GLPK_JANMA Glycerol kinase OS=Janthinobacterium sp. (strain Marseille) GN=glpK PE=3 SV=1 12 474 3.0E-122
sp|B9MBT7|GLPK_ACIET Glycerol kinase OS=Acidovorax ebreus (strain TPSY) GN=glpK PE=3 SV=1 3 468 6.0E-122
sp|B2A2C4|GLPK_NATTJ Glycerol kinase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=glpK PE=3 SV=1 11 475 8.0E-122
sp|Q7P1G2|GLPK_CHRVO Glycerol kinase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=glpK PE=3 SV=1 12 476 8.0E-122
sp|B2G7U6|GLPK_LACRJ Glycerol kinase OS=Lactobacillus reuteri (strain JCM 1112) GN=glpK PE=3 SV=1 12 468 9.0E-122
sp|A5VKE8|GLPK_LACRD Glycerol kinase OS=Lactobacillus reuteri (strain DSM 20016) GN=glpK PE=3 SV=1 12 468 9.0E-122
sp|Q12GA2|GLPK_POLSJ Glycerol kinase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=glpK PE=3 SV=1 3 471 1.0E-121
sp|Q48F01|GLPK_PSE14 Glycerol kinase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=glpK PE=3 SV=1 12 474 1.0E-121
sp|Q07WH4|GLPK_SHEFN Glycerol kinase OS=Shewanella frigidimarina (strain NCIMB 400) GN=glpK PE=3 SV=1 3 468 1.0E-121
sp|Q67Q63|GLPK_SYMTH Glycerol kinase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=glpK PE=3 SV=1 12 475 1.0E-121
sp|A6M1Y8|GLPK_CLOB8 Glycerol kinase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=glpK PE=3 SV=1 9 474 2.0E-121
sp|Q0BC36|GLPK_BURCM Glycerol kinase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=glpK PE=3 SV=1 12 476 2.0E-121
sp|C4ZGB4|GLPK_EUBR3 Glycerol kinase OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=glpK PE=3 SV=1 12 475 3.0E-121
sp|Q0TMA0|GLPK_CLOP1 Glycerol kinase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=glpK PE=3 SV=1 10 475 3.0E-121
sp|A6TFR2|GLPK_KLEP7 Glycerol kinase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=glpK PE=3 SV=1 12 474 4.0E-121
sp|Q8XHD3|GLPK_CLOPE Glycerol kinase OS=Clostridium perfringens (strain 13 / Type A) GN=glpK PE=3 SV=1 10 475 5.0E-121
sp|Q0SQ01|GLPK_CLOPS Glycerol kinase OS=Clostridium perfringens (strain SM101 / Type A) GN=glpK PE=3 SV=1 10 475 5.0E-121
sp|A2SM29|GLPK_METPP Glycerol kinase OS=Methylibium petroleiphilum (strain PM1) GN=glpK PE=3 SV=1 12 471 5.0E-121
sp|B5EB79|GLPK_GEOBB Glycerol kinase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=glpK PE=3 SV=1 3 474 6.0E-121
sp|Q63X50|GLPK_BURPS Glycerol kinase OS=Burkholderia pseudomallei (strain K96243) GN=glpK PE=3 SV=1 12 476 7.0E-121
sp|B1YWB2|GLPK_BURA4 Glycerol kinase OS=Burkholderia ambifaria (strain MC40-6) GN=glpK PE=3 SV=1 12 476 7.0E-121
sp|B5XTD4|GLPK_KLEP3 Glycerol kinase OS=Klebsiella pneumoniae (strain 342) GN=glpK PE=3 SV=1 12 474 1.0E-120
sp|A9AFH2|GLPK_BURM1 Glycerol kinase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=glpK PE=3 SV=1 12 476 1.0E-120
sp|Q2T0Z3|GLPK_BURTA Glycerol kinase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=glpK PE=3 SV=1 12 476 1.0E-120
sp|Q7MYB6|GLPK_PHOLL Glycerol kinase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=glpK PE=3 SV=2 12 476 2.0E-120
sp|B1Y1L9|GLPK_LEPCP Glycerol kinase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=glpK PE=3 SV=1 3 471 2.0E-120
sp|A8AL00|GLPK_CITK8 Glycerol kinase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=glpK PE=3 SV=1 12 476 3.0E-120
sp|B2JD95|GLPK_BURP8 Glycerol kinase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=glpK PE=3 SV=1 12 476 5.0E-120
sp|Q3K7I5|GLPK_PSEPF Glycerol kinase OS=Pseudomonas fluorescens (strain Pf0-1) GN=glpK PE=3 SV=1 12 475 5.0E-120
sp|Q316D5|GLPK_DESAG Glycerol kinase OS=Desulfovibrio alaskensis (strain G20) GN=glpK PE=3 SV=1 12 475 8.0E-120
sp|P44400|GLPK_HAEIN Glycerol kinase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=glpK PE=3 SV=2 12 475 1.0E-119
sp|A8H995|GLPK_SHEPA Glycerol kinase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=glpK PE=3 SV=1 3 472 1.0E-119
sp|B2SYH7|GLPK_BURPP Glycerol kinase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=glpK PE=3 SV=1 12 476 2.0E-119
sp|B0K643|GLPK_THEPX Glycerol kinase OS=Thermoanaerobacter sp. (strain X514) GN=glpK PE=3 SV=1 12 475 2.0E-119
sp|A9VI58|GLPK_BACWK Glycerol kinase OS=Bacillus weihenstephanensis (strain KBAB4) GN=glpK PE=3 SV=1 12 472 3.0E-119
sp|C6C1M7|GLPK_DESAD Glycerol kinase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=glpK PE=3 SV=1 12 469 3.0E-119
sp|A4J8E6|GLPK_DESRM Glycerol kinase OS=Desulfotomaculum reducens (strain MI-1) GN=glpK PE=3 SV=1 12 475 4.0E-119
sp|Q8R8J4|GLPK_CALS4 Glycerol kinase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=glpK PE=3 SV=1 12 475 4.0E-119
sp|A4JHM8|GLPK_BURVG Glycerol kinase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=glpK PE=3 SV=1 12 476 4.0E-119
sp|Q97JG4|GLPK_CLOAB Glycerol kinase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=glpK PE=3 SV=1 12 474 4.0E-119
sp|B0K754|GLPK_THEP3 Glycerol kinase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=glpK PE=3 SV=1 12 475 6.0E-119
sp|A9MI40|GLPK_SALAR Glycerol kinase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=glpK PE=3 SV=1 12 474 6.0E-119
sp|A4SPA7|GLPK_AERS4 Glycerol kinase OS=Aeromonas salmonicida (strain A449) GN=glpK PE=3 SV=1 12 475 7.0E-119
sp|B5F0R7|GLPK_SALA4 Glycerol kinase OS=Salmonella agona (strain SL483) GN=glpK PE=3 SV=1 12 476 9.0E-119
sp|Q63EX2|GLPK_BACCZ Glycerol kinase OS=Bacillus cereus (strain ZK / E33L) GN=glpK PE=3 SV=1 12 472 1.0E-118
sp|C1EKE4|GLPK_BACC3 Glycerol kinase OS=Bacillus cereus (strain 03BB102) GN=glpK PE=3 SV=1 12 472 1.0E-118
sp|A0RAP3|GLPK_BACAH Glycerol kinase OS=Bacillus thuringiensis (strain Al Hakam) GN=glpK PE=3 SV=1 12 472 1.0E-118
sp|B4TPU7|GLPK_SALSV Glycerol kinase OS=Salmonella schwarzengrund (strain CVM19633) GN=glpK PE=3 SV=1 12 474 1.0E-118
sp|B5BJK3|GLPK_SALPK Glycerol kinase OS=Salmonella paratyphi A (strain AKU_12601) GN=glpK PE=3 SV=1 12 474 1.0E-118
sp|C0Q436|GLPK_SALPC Glycerol kinase OS=Salmonella paratyphi C (strain RKS4594) GN=glpK PE=3 SV=1 12 474 1.0E-118
sp|A9MZH4|GLPK_SALPB Glycerol kinase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=glpK PE=3 SV=1 12 474 1.0E-118
sp|Q5PIS3|GLPK_SALPA Glycerol kinase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=glpK PE=3 SV=1 12 474 1.0E-118
sp|B4T0T2|GLPK_SALNS Glycerol kinase OS=Salmonella newport (strain SL254) GN=glpK PE=3 SV=1 12 474 1.0E-118
sp|B4TCM2|GLPK_SALHS Glycerol kinase OS=Salmonella heidelberg (strain SL476) GN=glpK PE=3 SV=1 12 474 1.0E-118
sp|B5RF85|GLPK_SALG2 Glycerol kinase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=glpK PE=3 SV=1 12 474 1.0E-118
sp|B5QXL5|GLPK_SALEP Glycerol kinase OS=Salmonella enteritidis PT4 (strain P125109) GN=glpK PE=3 SV=1 12 474 1.0E-118
sp|B5FPT4|GLPK_SALDC Glycerol kinase OS=Salmonella dublin (strain CT_02021853) GN=glpK PE=3 SV=1 12 474 1.0E-118
sp|Q57HD1|GLPK_SALCH Glycerol kinase OS=Salmonella choleraesuis (strain SC-B67) GN=glpK PE=3 SV=1 12 474 1.0E-118
sp|A0KIT3|GLPK_AERHH Glycerol kinase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=glpK PE=3 SV=1 12 475 1.0E-118
sp|A8F679|GLPK_PSELT Glycerol kinase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=glpK PE=3 SV=1 12 474 2.0E-118
sp|P18157|GLPK_BACSU Glycerol kinase OS=Bacillus subtilis (strain 168) GN=glpK PE=1 SV=2 12 469 2.0E-118
sp|Q13UE3|GLPK_BURXL Glycerol kinase OS=Burkholderia xenovorans (strain LB400) GN=glpK PE=3 SV=1 12 476 2.0E-118
sp|A1WKB4|GLPK_VEREI Glycerol kinase OS=Verminephrobacter eiseniae (strain EF01-2) GN=glpK PE=3 SV=1 12 471 2.0E-118
sp|B7LUS9|GLPK_ESCF3 Glycerol kinase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=glpK PE=3 SV=1 12 474 4.0E-118
sp|Q6HMD5|GLPK_BACHK Glycerol kinase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=glpK PE=3 SV=1 12 472 4.0E-118
sp|B7HYU3|GLPK_BACC7 Glycerol kinase OS=Bacillus cereus (strain AH187) GN=glpK PE=3 SV=1 12 472 4.0E-118
sp|B7JCV9|GLPK_BACC0 Glycerol kinase OS=Bacillus cereus (strain AH820) GN=glpK PE=3 SV=1 12 472 4.0E-118
sp|C3LCY4|GLPK_BACAC Glycerol kinase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=glpK PE=3 SV=1 12 472 4.0E-118
sp|Q8Z2Y6|GLPK_SALTI Glycerol kinase OS=Salmonella typhi GN=glpK PE=3 SV=3 12 474 4.0E-118
sp|B9IT52|GLPK_BACCQ Glycerol kinase OS=Bacillus cereus (strain Q1) GN=glpK PE=3 SV=1 12 472 4.0E-118
sp|Q4L607|GLPK_STAHJ Glycerol kinase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=glpK PE=3 SV=1 12 472 5.0E-118
sp|B7UNP6|GLPK_ECO27 Glycerol kinase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=glpK PE=3 SV=1 12 474 5.0E-118
sp|A1WT61|GLPK_HALHL Glycerol kinase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=glpK PE=3 SV=1 12 474 6.0E-118
sp|A6WIC0|GLPK_SHEB8 Glycerol kinase OS=Shewanella baltica (strain OS185) GN=glpK PE=3 SV=1 12 472 7.0E-118
sp|Q8ZKP3|GLPK_SALTY Glycerol kinase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=glpK PE=3 SV=3 12 474 7.0E-118
sp|Q5P212|GLPK_AROAE Glycerol kinase OS=Aromatoleum aromaticum (strain EbN1) GN=glpK PE=3 SV=1 12 474 7.0E-118
sp|A5UE44|GLPK_HAEIE Glycerol kinase OS=Haemophilus influenzae (strain PittEE) GN=glpK PE=3 SV=1 12 475 8.0E-118
sp|B7N2R7|GLPK_ECO81 Glycerol kinase OS=Escherichia coli O81 (strain ED1a) GN=glpK PE=3 SV=1 12 474 9.0E-118
sp|Q5L091|GLPK_GEOKA Glycerol kinase OS=Geobacillus kaustophilus (strain HTA426) GN=glpK PE=3 SV=1 12 469 1.0E-117
sp|Q32A92|GLPK_SHIDS Glycerol kinase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=glpK PE=3 SV=1 12 474 1.0E-117
sp|A5UHH7|GLPK_HAEIG Glycerol kinase OS=Haemophilus influenzae (strain PittGG) GN=glpK PE=3 SV=1 12 475 1.0E-117
sp|Q31U64|GLPK_SHIBS Glycerol kinase OS=Shigella boydii serotype 4 (strain Sb227) GN=glpK PE=3 SV=1 12 474 1.0E-117
sp|B1LNM9|GLPK_ECOSM Glycerol kinase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=glpK PE=3 SV=1 12 474 1.0E-117
sp|B7NFM3|GLPK_ECOLU Glycerol kinase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=glpK PE=3 SV=1 12 474 1.0E-117
sp|P0A6F3|GLPK_ECOLI Glycerol kinase OS=Escherichia coli (strain K12) GN=glpK PE=1 SV=2 12 474 1.0E-117
sp|B1IVF3|GLPK_ECOLC Glycerol kinase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=glpK PE=3 SV=1 12 474 1.0E-117
sp|Q0TAD8|GLPK_ECOL5 Glycerol kinase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=glpK PE=3 SV=1 12 474 1.0E-117
sp|A8A731|GLPK_ECOHS Glycerol kinase OS=Escherichia coli O9:H4 (strain HS) GN=glpK PE=3 SV=1 12 474 1.0E-117
sp|B1XB92|GLPK_ECODH Glycerol kinase OS=Escherichia coli (strain K12 / DH10B) GN=glpK PE=3 SV=1 12 474 1.0E-117
sp|C5A093|GLPK_ECOBW Glycerol kinase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=glpK PE=3 SV=1 12 474 1.0E-117
sp|B5YZ64|GLPK_ECO5E Glycerol kinase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=glpK PE=3 SV=1 12 474 1.0E-117
sp|P0A6F4|GLPK_ECO57 Glycerol kinase OS=Escherichia coli O157:H7 GN=glpK PE=3 SV=2 12 474 1.0E-117
sp|B7LA23|GLPK_ECO55 Glycerol kinase OS=Escherichia coli (strain 55989 / EAEC) GN=glpK PE=3 SV=1 12 474 1.0E-117
sp|B7MI58|GLPK_ECO45 Glycerol kinase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=glpK PE=3 SV=1 12 474 1.0E-117
sp|A7ZUE0|GLPK_ECO24 Glycerol kinase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=glpK PE=3 SV=1 12 474 1.0E-117
sp|Q7UB84|GLPK_SHIFL Glycerol kinase OS=Shigella flexneri GN=glpK PE=3 SV=2 12 474 1.0E-117
sp|B7NU81|GLPK_ECO7I Glycerol kinase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=glpK PE=3 SV=1 12 474 1.0E-117
sp|B8E4K9|GLPK_SHEB2 Glycerol kinase OS=Shewanella baltica (strain OS223) GN=glpK PE=3 SV=1 12 472 1.0E-117
sp|Q8FBC3|GLPK_ECOL6 Glycerol kinase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=glpK PE=3 SV=3 12 474 2.0E-117
sp|A1VA10|GLPK_DESVV Glycerol kinase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=glpK PE=3 SV=1 12 474 2.0E-117
sp|Q726H4|GLPK_DESVH Glycerol kinase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=glpK PE=3 SV=1 12 474 2.0E-117
sp|B8DL62|GLPK_DESVM Glycerol kinase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=glpK PE=3 SV=1 12 476 2.0E-117
sp|Q81U58|GLPK_BACAN Glycerol kinase OS=Bacillus anthracis GN=glpK PE=3 SV=1 12 472 2.0E-117
sp|C3P2T3|GLPK_BACAA Glycerol kinase OS=Bacillus anthracis (strain A0248) GN=glpK PE=3 SV=1 12 472 2.0E-117
sp|A3CZL0|GLPK_SHEB5 Glycerol kinase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=glpK PE=3 SV=1 12 472 2.0E-117
sp|Q4QMM7|GLPK_HAEI8 Glycerol kinase OS=Haemophilus influenzae (strain 86-028NP) GN=glpK PE=3 SV=1 12 475 2.0E-117
sp|C5CSQ9|GLPK_VARPS Glycerol kinase OS=Variovorax paradoxus (strain S110) GN=glpK PE=3 SV=1 12 471 3.0E-117
sp|Q8PDI0|GLPK_XANCP Glycerol kinase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=glpK PE=3 SV=1 12 474 3.0E-117
sp|B0RMN0|GLPK_XANCB Glycerol kinase OS=Xanthomonas campestris pv. campestris (strain B100) GN=glpK PE=3 SV=1 12 474 3.0E-117
sp|A1VJ23|GLPK_POLNA Glycerol kinase OS=Polaromonas naphthalenivorans (strain CJ2) GN=glpK PE=3 SV=1 3 471 3.0E-117
sp|Q8E1T0|GLPK_STRA5 Glycerol kinase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=glpK PE=3 SV=1 12 475 3.0E-117
sp|Q8E794|GLPK_STRA3 Glycerol kinase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=glpK PE=3 SV=1 12 475 3.0E-117
sp|Q3K3A6|GLPK_STRA1 Glycerol kinase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=glpK PE=3 SV=1 12 475 3.0E-117
sp|Q4UZR8|GLPK_XANC8 Glycerol kinase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=glpK PE=3 SV=1 12 474 3.0E-117
sp|A9KY18|GLPK_SHEB9 Glycerol kinase OS=Shewanella baltica (strain OS195) GN=glpK PE=3 SV=1 12 472 3.0E-117
sp|B7M6X7|GLPK_ECO8A Glycerol kinase OS=Escherichia coli O8 (strain IAI1) GN=glpK PE=3 SV=1 12 474 3.0E-117
sp|C3NAM2|GLPK_SULIY Glycerol kinase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=glpK PE=3 SV=1 14 475 4.0E-117
sp|C3MP45|GLPK_SULIL Glycerol kinase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=glpK PE=3 SV=1 14 475 4.0E-117
sp|O34153|GLPK_ENTCA Glycerol kinase OS=Enterococcus casseliflavus GN=glpK PE=1 SV=3 12 468 4.0E-117
sp|Q97XW1|GLPK1_SULSO Glycerol kinase 1 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=glpK1 PE=3 SV=1 14 475 4.0E-117
sp|B1KKY8|GLPK_SHEWM Glycerol kinase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=glpK PE=3 SV=1 12 471 5.0E-117
sp|A4WG72|GLPK_ENT38 Glycerol kinase OS=Enterobacter sp. (strain 638) GN=glpK PE=3 SV=1 12 474 6.0E-117
sp|C1DHV0|GLPK_AZOVD Glycerol kinase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=glpK PE=3 SV=1 12 476 6.0E-117
sp|Q4K734|GLPK_PSEF5 Glycerol kinase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=glpK PE=3 SV=1 12 474 6.0E-117
sp|A0L1Q5|GLPK_SHESA Glycerol kinase OS=Shewanella sp. (strain ANA-3) GN=glpK PE=3 SV=1 12 472 7.0E-117
sp|Q8NZW9|GLPK_STRP8 Glycerol kinase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=glpK PE=3 SV=1 12 472 7.0E-117
sp|C3MUZ1|GLPK_SULIM Glycerol kinase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=glpK PE=3 SV=1 14 475 8.0E-117
sp|C4KEH1|GLPK_SULIK Glycerol kinase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=glpK PE=3 SV=1 14 475 8.0E-117
sp|B4SJT3|GLPK_STRM5 Glycerol kinase OS=Stenotrophomonas maltophilia (strain R551-3) GN=glpK PE=3 SV=1 3 468 9.0E-117
sp|O34154|GLPK_ENTFA Glycerol kinase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=glpK PE=1 SV=3 12 468 9.0E-117
sp|Q8XUY1|GLPK_RALSO Glycerol kinase OS=Ralstonia solanacearum (strain GMI1000) GN=glpK PE=3 SV=1 3 472 1.0E-116
sp|Q1J5E4|GLPK_STRPF Glycerol kinase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=glpK PE=3 SV=1 12 472 1.0E-116
sp|Q21944|GLPK_CAEEL Probable glycerol kinase OS=Caenorhabditis elegans GN=R11F4.1 PE=3 SV=1 12 476 1.0E-116
sp|B9EBI8|GLPK_MACCJ Glycerol kinase OS=Macrococcus caseolyticus (strain JCSC5402) GN=glpK PE=3 SV=1 12 472 1.0E-116
sp|Q3BYR0|GLPK_XANC5 Glycerol kinase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=glpK PE=3 SV=1 12 474 1.0E-116
sp|C3KBM0|GLPK_PSEFS Glycerol kinase OS=Pseudomonas fluorescens (strain SBW25) GN=glpK PE=3 SV=1 12 474 1.0E-116
sp|B7IKB1|GLPK_BACC2 Glycerol kinase OS=Bacillus cereus (strain G9842) GN=glpK PE=3 SV=1 12 472 1.0E-116
sp|C3N2M3|GLPK_SULIA Glycerol kinase OS=Sulfolobus islandicus (strain M.16.27) GN=glpK PE=3 SV=1 14 475 2.0E-116
sp|Q8E9N7|GLPK_SHEON Glycerol kinase OS=Shewanella oneidensis (strain MR-1) GN=glpK PE=3 SV=1 12 472 2.0E-116
sp|B2TWC2|GLPK_SHIB3 Glycerol kinase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=glpK PE=3 SV=1 12 474 2.0E-116
sp|A1REY5|GLPK_SHESW Glycerol kinase OS=Shewanella sp. (strain W3-18-1) GN=glpK PE=3 SV=1 12 472 2.0E-116
sp|A4Y2M5|GLPK_SHEPC Glycerol kinase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=glpK PE=3 SV=1 12 472 2.0E-116
sp|C6E1L8|GLPK_GEOSM Glycerol kinase OS=Geobacter sp. (strain M21) GN=glpK PE=3 SV=1 9 474 2.0E-116
sp|A3CPV3|GLPK_STRSV Glycerol kinase OS=Streptococcus sanguinis (strain SK36) GN=glpK PE=3 SV=1 12 475 2.0E-116
sp|Q0HZS9|GLPK_SHESR Glycerol kinase OS=Shewanella sp. (strain MR-7) GN=glpK PE=3 SV=1 12 472 2.0E-116
sp|Q51390|GLPK2_PSEAE Glycerol kinase 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=glpK2 PE=3 SV=2 3 474 2.0E-116
sp|B2UF87|GLPK_RALPJ Glycerol kinase OS=Ralstonia pickettii (strain 12J) GN=glpK PE=3 SV=1 3 472 3.0E-116
sp|Q0HE70|GLPK_SHESM Glycerol kinase OS=Shewanella sp. (strain MR-4) GN=glpK PE=3 SV=1 12 472 4.0E-116
sp|Q38XX6|GLPK_LACSS Glycerol kinase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=glpK PE=3 SV=1 2 472 4.0E-116
sp|B2FI02|GLPK_STRMK Glycerol kinase OS=Stenotrophomonas maltophilia (strain K279a) GN=glpK PE=3 SV=1 3 468 4.0E-116
sp|B1I9Z6|GLPK_STRPI Glycerol kinase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=glpK PE=3 SV=1 12 475 4.0E-116
sp|C1CNF8|GLPK_STRZP Glycerol kinase OS=Streptococcus pneumoniae (strain P1031) GN=glpK PE=3 SV=1 12 475 5.0E-116
sp|A8AVX5|GLPK_STRGC Glycerol kinase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=glpK PE=3 SV=1 12 475 5.0E-116
sp|O66131|GLPK_THETH Glycerol kinase OS=Thermus thermophilus GN=glpK PE=1 SV=1 12 469 5.0E-116
sp|B5XMM6|GLPK_STRPZ Glycerol kinase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=glpK PE=3 SV=1 12 472 5.0E-116
sp|A2RD27|GLPK_STRPG Glycerol kinase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=glpK PE=3 SV=1 12 472 5.0E-116
sp|Q1JFJ5|GLPK_STRPD Glycerol kinase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=glpK PE=3 SV=1 12 472 5.0E-116
sp|Q1JKK3|GLPK_STRPC Glycerol kinase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=glpK PE=3 SV=1 12 472 5.0E-116
sp|Q1JAF2|GLPK_STRPB Glycerol kinase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=glpK PE=3 SV=1 12 472 5.0E-116
sp|Q99YI7|GLPK_STRP1 Glycerol kinase OS=Streptococcus pyogenes serotype M1 GN=glpK PE=3 SV=1 12 472 5.0E-116
sp|Q81GZ2|GLPK_BACCR Glycerol kinase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=glpK PE=3 SV=1 12 472 5.0E-116
sp|B7HG04|GLPK_BACC4 Glycerol kinase OS=Bacillus cereus (strain B4264) GN=glpK PE=3 SV=1 12 472 5.0E-116
sp|B0TQM6|GLPK_SHEHH Glycerol kinase OS=Shewanella halifaxensis (strain HAW-EB4) GN=glpK PE=3 SV=1 3 472 5.0E-116
sp|Q8RHZ9|GLPK_FUSNN Glycerol kinase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=glpK PE=3 SV=1 9 474 5.0E-116
sp|A7Z2U3|GLPK_BACMF Glycerol kinase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=glpK PE=3 SV=1 12 469 5.0E-116
sp|C1CUA3|GLPK_STRZT Glycerol kinase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=glpK PE=3 SV=1 12 475 6.0E-116
sp|C1CHI6|GLPK_STRZJ Glycerol kinase OS=Streptococcus pneumoniae (strain JJA) GN=glpK PE=3 SV=1 12 475 6.0E-116
sp|P63743|GLPK_STRR6 Glycerol kinase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=glpK PE=3 SV=1 12 475 6.0E-116
sp|B2INK5|GLPK_STRPS Glycerol kinase OS=Streptococcus pneumoniae (strain CGSP14) GN=glpK PE=3 SV=1 12 475 6.0E-116
sp|P63742|GLPK_STRPN Glycerol kinase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=glpK PE=3 SV=1 12 475 6.0E-116
sp|Q04HZ0|GLPK_STRP2 Glycerol kinase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=glpK PE=3 SV=1 12 475 6.0E-116
sp|C0Z5A8|GLPK_BREBN Glycerol kinase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=glpK PE=3 SV=1 12 474 7.0E-116
sp|P0DA17|GLPK_STRPQ Glycerol kinase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=glpK PE=3 SV=1 12 472 7.0E-116
sp|P0DA16|GLPK_STRP3 Glycerol kinase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=glpK PE=3 SV=1 12 472 7.0E-116
sp|Q5XAJ9|GLPK_STRP6 Glycerol kinase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=glpK PE=3 SV=1 12 472 8.0E-116
sp|B8ZQ22|GLPK_STRPJ Glycerol kinase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=glpK PE=3 SV=1 12 475 8.0E-116
sp|B5E3S7|GLPK_STRP4 Glycerol kinase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=glpK PE=3 SV=1 12 475 9.0E-116
sp|A7GLY7|GLPK_BACCN Glycerol kinase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=glpK PE=3 SV=1 12 472 1.0E-115
sp|P32190|GLPK_YEAST Glycerol kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GUT1 PE=3 SV=1 12 474 1.0E-115
sp|Q48RX6|GLPK_STRPM Glycerol kinase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=glpK PE=3 SV=1 12 472 1.0E-115
sp|Q8PQG7|GLPK_XANAC Glycerol kinase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=glpK PE=3 SV=2 12 474 1.0E-115
sp|Q4J7A3|GLPK2_SULAC Glycerol kinase 2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=glpK2 PE=3 SV=1 14 475 1.0E-115
sp|C1CBG2|GLPK_STRP7 Glycerol kinase OS=Streptococcus pneumoniae (strain 70585) GN=glpK PE=3 SV=1 12 475 2.0E-115
sp|A4YLX6|GLPK_BRASO Glycerol kinase OS=Bradyrhizobium sp. (strain ORS278) GN=glpK PE=3 SV=1 12 469 2.0E-115
sp|A1S2E6|GLPK_SHEAM Glycerol kinase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=glpK PE=3 SV=1 12 471 2.0E-115
sp|A1K962|GLPK_AZOSB Glycerol kinase OS=Azoarcus sp. (strain BH72) GN=glpK PE=3 SV=1 12 475 3.0E-115
sp|Q98QY9|GLPK_MYCPU Glycerol kinase OS=Mycoplasma pulmonis (strain UAB CTIP) GN=glpK PE=3 SV=1 12 474 5.0E-115
sp|A5ES06|GLPK_BRASB Glycerol kinase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=glpK PE=3 SV=1 12 469 6.0E-115
sp|Q5V4I4|GLPK_HALMA Glycerol kinase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=glpK PE=3 SV=1 12 476 6.0E-115
sp|B8CM45|GLPK_SHEPW Glycerol kinase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=glpK PE=3 SV=1 3 472 8.0E-115
sp|A8FQ89|GLPK_SHESH Glycerol kinase OS=Shewanella sediminis (strain HAW-EB3) GN=glpK PE=3 SV=1 12 468 9.0E-115
sp|Q87M72|GLPK_VIBPA Glycerol kinase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=glpK PE=3 SV=1 12 475 1.0E-114
sp|Q73CE0|GLPK_BACC1 Glycerol kinase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=glpK PE=3 SV=1 12 439 1.0E-114
sp|P57944|GLPK_PASMU Glycerol kinase OS=Pasteurella multocida (strain Pm70) GN=glpK PE=3 SV=1 12 474 1.0E-114
sp|A8Z1X0|GLPK_STAAT Glycerol kinase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=glpK PE=3 SV=1 12 472 2.0E-114
sp|A6QGJ8|GLPK_STAAE Glycerol kinase OS=Staphylococcus aureus (strain Newman) GN=glpK PE=3 SV=1 12 472 2.0E-114
sp|Q5HGD2|GLPK_STAAC Glycerol kinase OS=Staphylococcus aureus (strain COL) GN=glpK PE=1 SV=1 12 472 2.0E-114
sp|Q2FYZ5|GLPK_STAA8 Glycerol kinase OS=Staphylococcus aureus (strain NCTC 8325) GN=glpK PE=3 SV=1 12 472 2.0E-114
sp|Q2FHD9|GLPK_STAA3 Glycerol kinase OS=Staphylococcus aureus (strain USA300) GN=glpK PE=3 SV=1 12 472 2.0E-114
sp|Q8Y6Z2|GLPK_LISMO Glycerol kinase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=glpK PE=3 SV=1 12 472 3.0E-114
sp|Q9WX53|GLPK_THEAQ Glycerol kinase OS=Thermus aquaticus GN=glpK PE=1 SV=1 12 469 3.0E-114
sp|C5DA06|GLPK_GEOSW Glycerol kinase OS=Geobacillus sp. (strain WCH70) GN=glpK PE=3 SV=1 12 469 4.0E-114
sp|Q71ZD2|GLPK_LISMF Glycerol kinase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=glpK PE=3 SV=1 12 472 4.0E-114
sp|C1KVI5|GLPK_LISMC Glycerol kinase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=glpK PE=3 SV=1 12 472 4.0E-114
sp|Q5FHZ6|GLPK_LACAC Glycerol kinase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=glpK PE=3 SV=1 12 476 5.0E-114
sp|B8DHL0|GLPK_LISMH Glycerol kinase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=glpK PE=3 SV=1 12 472 5.0E-114
sp|B8J0H2|GLPK_DESDA Glycerol kinase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=glpK PE=3 SV=1 9 474 5.0E-114
sp|Q49X93|GLPK_STAS1 Glycerol kinase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=glpK PE=3 SV=1 12 472 6.0E-114
sp|A7N1R1|GLPK_VIBCB Glycerol kinase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=glpK PE=3 SV=1 12 475 1.0E-113
sp|B9DV90|GLPK_STRU0 Glycerol kinase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=glpK PE=3 SV=1 12 475 1.0E-113
sp|Q6GHD5|GLPK_STAAR Glycerol kinase OS=Staphylococcus aureus (strain MRSA252) GN=glpK PE=3 SV=1 12 472 2.0E-113
sp|P99113|GLPK_STAAN Glycerol kinase OS=Staphylococcus aureus (strain N315) GN=glpK PE=1 SV=1 12 472 2.0E-113
sp|P63741|GLPK_STAAM Glycerol kinase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=glpK PE=3 SV=1 12 472 2.0E-113
sp|A5ISI2|GLPK_STAA9 Glycerol kinase OS=Staphylococcus aureus (strain JH9) GN=glpK PE=3 SV=1 12 472 2.0E-113
sp|A6U1B8|GLPK_STAA2 Glycerol kinase OS=Staphylococcus aureus (strain JH1) GN=glpK PE=3 SV=1 12 472 2.0E-113
sp|A7X1U3|GLPK_STAA1 Glycerol kinase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=glpK PE=3 SV=1 12 472 2.0E-113
sp|C4XGV9|GLPK_DESMR Glycerol kinase OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=glpK PE=3 SV=1 12 474 2.0E-113
sp|Q8NWX7|GLPK_STAAW Glycerol kinase OS=Staphylococcus aureus (strain MW2) GN=glpK PE=3 SV=1 12 472 2.0E-113
sp|Q9V207|GLPK_PYRAB Glycerol kinase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=glpK PE=3 SV=2 12 476 2.0E-113
sp|Q7W3R1|GLPK_BORPA Glycerol kinase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=glpK PE=3 SV=1 12 475 2.0E-113
sp|Q7WF38|GLPK_BORBR Glycerol kinase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=glpK PE=3 SV=1 12 475 2.0E-113
sp|Q0SNS0|GLPK_BORAP Glycerol kinase OS=Borrelia afzelii (strain PKo) GN=glpK PE=3 SV=1 11 474 4.0E-113
sp|A0AIY7|GLPK_LISW6 Glycerol kinase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=glpK PE=3 SV=1 12 472 4.0E-113
sp|Q133H2|GLPK_RHOPS Glycerol kinase OS=Rhodopseudomonas palustris (strain BisB5) GN=glpK PE=3 SV=1 12 469 4.0E-113
sp|B7J1G9|GLPK_BORBZ Glycerol kinase OS=Borrelia burgdorferi (strain ZS7) GN=glpK PE=3 SV=1 11 474 4.0E-113
sp|O51257|GLPK_BORBU Glycerol kinase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=glpK PE=3 SV=1 11 474 4.0E-113
sp|Q8CSS0|GLPK_STAES Glycerol kinase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=glpK PE=3 SV=1 12 472 4.0E-113
sp|Q5HPP1|GLPK_STAEQ Glycerol kinase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=glpK PE=3 SV=1 12 472 4.0E-113
sp|Q6G9R3|GLPK_STAAS Glycerol kinase OS=Staphylococcus aureus (strain MSSA476) GN=glpK PE=3 SV=1 12 472 4.0E-113
sp|Q92BH6|GLPK_LISIN Glycerol kinase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=glpK PE=3 SV=1 12 472 4.0E-113
sp|O66746|GLPK_AQUAE Glycerol kinase OS=Aquifex aeolicus (strain VF5) GN=glpK PE=3 SV=1 3 475 5.0E-113
sp|Q18JE8|GLPK_HALWD Glycerol kinase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=glpK PE=3 SV=1 12 476 5.0E-113
sp|Q88YD9|GLPK2_LACPL Glycerol kinase 2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=glpK2 PE=3 SV=1 2 472 6.0E-113
sp|P95907|GLPK2_SULSO Glycerol kinase 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=glpK2 PE=3 SV=1 14 474 7.0E-113
sp|Q4J9R1|GLPK1_SULAC Glycerol kinase 1 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=glpK1 PE=3 SV=1 14 475 8.0E-113
sp|Q2YXR6|GLPK_STAAB Glycerol kinase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=glpK PE=3 SV=1 12 472 8.0E-113
sp|B7VQ85|GLPK_VIBTL Glycerol kinase OS=Vibrio tasmaniensis (strain LGP32) GN=glpK PE=3 SV=1 12 475 8.0E-113
sp|C0QVC0|GLPK_BRAHW Glycerol kinase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=glpK PE=3 SV=1 10 475 9.0E-113
sp|O87924|GLPK_PSETO Glycerol kinase OS=Pseudomonas tolaasii GN=glpK PE=3 SV=1 12 474 1.0E-112
sp|Q9X6C9|GLPK_THEBO Glycerol kinase OS=Thermus brockianus GN=glpK PE=3 SV=1 3 476 2.0E-112
sp|Q7MI93|GLPK_VIBVY Glycerol kinase OS=Vibrio vulnificus (strain YJ016) GN=glpK PE=3 SV=1 12 475 2.0E-112
sp|Q8DBM6|GLPK_VIBVU Glycerol kinase OS=Vibrio vulnificus (strain CMCP6) GN=glpK PE=3 SV=1 12 475 2.0E-112
sp|Q07K31|GLPK_RHOP5 Glycerol kinase OS=Rhodopseudomonas palustris (strain BisA53) GN=glpK PE=3 SV=1 12 469 2.0E-112
sp|C3LW10|GLPK_VIBCM Glycerol kinase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=glpK PE=3 SV=1 12 475 2.0E-112
sp|Q662C3|GLPK_BORBP Glycerol kinase OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=glpK PE=3 SV=1 11 474 3.0E-112
sp|A5EZR2|GLPK_VIBC3 Glycerol kinase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=glpK PE=3 SV=1 12 475 3.0E-112
sp|B2V358|GLPK_CLOBA Glycerol kinase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=glpK PE=3 SV=1 10 475 3.0E-112
sp|Q5E0Z0|GLPK_VIBF1 Glycerol kinase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=glpK PE=3 SV=1 12 475 4.0E-112
sp|Q9NJP9|GLPK_TRYBB Glycerol kinase, glycosomal OS=Trypanosoma brucei brucei GN=GK PE=1 SV=1 12 441 4.0E-112
sp|Q9KLJ9|GLPK_VIBCH Glycerol kinase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=glpK PE=3 SV=1 12 475 4.0E-112
sp|Q7VSU7|GLPK_BORPE Glycerol kinase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=glpK PE=3 SV=1 12 475 5.0E-112
sp|D4GYI5|GLPK_HALVD Glycerol kinase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=glpK PE=2 SV=1 12 475 5.0E-112
sp|Q21S75|GLPK_RHOFT Glycerol kinase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=glpK PE=3 SV=1 12 471 6.0E-112
sp|A9BRV2|GLPK_DELAS Glycerol kinase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=glpK PE=3 SV=1 12 468 6.0E-112
sp|B2TN12|GLPK_CLOBB Glycerol kinase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=glpK PE=3 SV=1 10 475 7.0E-112
sp|Q1QR91|GLPK_NITHX Glycerol kinase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=glpK PE=3 SV=1 12 469 9.0E-112
sp|B6ER09|GLPK_ALISL Glycerol kinase OS=Aliivibrio salmonicida (strain LFI1238) GN=glpK PE=3 SV=1 12 475 9.0E-112
sp|O93623|GLPK_THEKO Glycerol kinase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=glpK PE=1 SV=2 12 476 9.0E-112
sp|Q893Q3|GLPK1_CLOTE Glycerol kinase 1 OS=Clostridium tetani (strain Massachusetts / E88) GN=glpK1 PE=3 SV=1 1 474 1.0E-111
sp|Q9CG64|GLPK_LACLA Glycerol kinase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=glpK PE=3 SV=1 10 472 2.0E-111
sp|C1FUW6|GLPK_CLOBJ Glycerol kinase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=glpK PE=3 SV=1 12 476 2.0E-111
sp|C5A1M3|GLPK_THEGJ Glycerol kinase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=glpK PE=3 SV=1 12 476 3.0E-111
sp|Q7UTP4|GLPK_RHOBA Glycerol kinase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=glpK PE=3 SV=1 12 452 3.0E-111
sp|Q89UK6|GLPK_BRADU Glycerol kinase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=glpK PE=3 SV=1 12 469 3.0E-111
sp|Q9PB76|GLPK_XYLFA Glycerol kinase OS=Xylella fastidiosa (strain 9a5c) GN=glpK PE=3 SV=2 12 474 3.0E-111
sp|A7GH02|GLPK_CLOBL Glycerol kinase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=glpK PE=3 SV=1 12 474 4.0E-111
sp|A6TKR6|GLPK_ALKMQ Glycerol kinase OS=Alkaliphilus metalliredigens (strain QYMF) GN=glpK PE=3 SV=1 2 474 4.0E-111
sp|B1IKJ7|GLPK_CLOBK Glycerol kinase OS=Clostridium botulinum (strain Okra / Type B1) GN=glpK PE=3 SV=1 12 474 4.0E-111
sp|B1KYK0|GLPK_CLOBM Glycerol kinase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=glpK PE=3 SV=1 12 474 5.0E-111
sp|C3L254|GLPK_CLOB6 Glycerol kinase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=glpK PE=3 SV=1 12 476 5.0E-111
sp|B8IKN3|GLPK_METNO Glycerol kinase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=glpK PE=3 SV=1 12 468 6.0E-111
sp|Q87BZ2|GLPK_XYLFT Glycerol kinase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=glpK PE=3 SV=1 12 474 6.0E-111
sp|B2I618|GLPK_XYLF2 Glycerol kinase OS=Xylella fastidiosa (strain M23) GN=glpK PE=3 SV=1 12 474 6.0E-111
sp|B5ET10|GLPK_VIBFM Glycerol kinase OS=Vibrio fischeri (strain MJ11) GN=glpK PE=3 SV=1 12 475 8.0E-111
sp|A5I5M0|GLPK_CLOBH Glycerol kinase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=glpK PE=3 SV=1 12 474 8.0E-111
sp|A7FX30|GLPK_CLOB1 Glycerol kinase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=glpK PE=3 SV=1 12 474 8.0E-111
sp|A8MG11|GLPK_ALKOO Glycerol kinase OS=Alkaliphilus oremlandii (strain OhILAs) GN=glpK PE=3 SV=1 12 474 8.0E-111
sp|Q3M3M2|GLPK_ANAVT Glycerol kinase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=glpK PE=3 SV=1 12 474 8.0E-111
sp|Q6FDN3|GLPK_ACIAD Glycerol kinase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=glpK PE=3 SV=1 9 472 1.0E-110
sp|B0TWZ7|GLPK_FRAP2 Glycerol kinase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=glpK PE=3 SV=1 12 475 1.0E-110
sp|A1SZE1|GLPK_PSYIN Glycerol kinase OS=Psychromonas ingrahamii (strain 37) GN=glpK PE=3 SV=1 12 475 2.0E-110
sp|A3QIN4|GLPK_SHELP Glycerol kinase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=glpK PE=3 SV=1 3 468 2.0E-110
sp|Q03DS8|GLPK_PEDPA Glycerol kinase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=glpK PE=3 SV=1 2 472 3.0E-110
sp|Q1WVJ0|GLPK_LACS1 Glycerol kinase OS=Lactobacillus salivarius (strain UCC118) GN=glpK PE=3 SV=1 12 472 5.0E-110
sp|Q88ZF1|GLPK1_LACPL Glycerol kinase 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=glpK1 PE=3 SV=1 2 472 6.0E-110
sp|Q8EVD0|GLPK_MYCPE Glycerol kinase OS=Mycoplasma penetrans (strain HF-2) GN=glpK PE=3 SV=1 12 476 1.0E-109
sp|Q9KDW8|GLPK_BACHD Glycerol kinase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=glpK PE=3 SV=1 12 472 1.0E-109
sp|A5VUC1|GLPK_BRUO2 Glycerol kinase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=glpK PE=3 SV=1 12 431 2.0E-109
sp|Q8YBR2|GLPK_BRUME Glycerol kinase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=glpK PE=3 SV=3 12 431 2.0E-109
sp|A9MB89|GLPK_BRUC2 Glycerol kinase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=glpK PE=3 SV=1 12 431 2.0E-109
sp|B6YT00|GLPK_THEON Glycerol kinase OS=Thermococcus onnurineus (strain NA1) GN=glpK PE=3 SV=1 12 476 2.0E-109
sp|Q15Q03|GLPK_PSEA6 Glycerol kinase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=glpK PE=3 SV=1 9 474 2.0E-109
sp|B5RL65|GLPK_BORDL Glycerol kinase OS=Borrelia duttonii (strain Ly) GN=glpK PE=3 SV=1 11 474 3.0E-109
sp|B6IQI0|GLPK_RHOCS Glycerol kinase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=glpK PE=3 SV=1 10 472 4.0E-109
sp|Q73LE9|GLPK_TREDE Glycerol kinase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=glpK PE=3 SV=1 12 475 6.0E-109
sp|Q65M11|GLPK_BACLD Glycerol kinase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=glpK PE=3 SV=1 12 472 7.0E-109
sp|A9WYC6|GLPK_BRUSI Glycerol kinase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=glpK PE=3 SV=1 12 431 7.0E-109
sp|P47284|GLPK_MYCGE Glycerol kinase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=glpK PE=3 SV=1 9 474 1.0E-108
sp|Q8YW05|GLPK_NOSS1 Glycerol kinase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=glpK PE=3 SV=1 12 474 1.0E-108
sp|Q8FWK8|GLPK_BRUSU Glycerol kinase OS=Brucella suis biovar 1 (strain 1330) GN=glpK PE=3 SV=1 12 431 1.0E-108
sp|Q1CXI5|GLPK_MYXXD Glycerol kinase OS=Myxococcus xanthus (strain DK 1622) GN=glpK PE=3 SV=1 11 469 1.0E-108
sp|Q7NC65|GLPK_MYCGA Glycerol kinase OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=glpK PE=3 SV=2 12 474 2.0E-108
sp|B0U3F2|GLPK_XYLFM Glycerol kinase OS=Xylella fastidiosa (strain M12) GN=glpK PE=3 SV=1 12 474 3.0E-108
sp|A4XXN1|GLPK_PSEMY Glycerol kinase OS=Pseudomonas mendocina (strain ymp) GN=glpK PE=3 SV=1 1 472 3.0E-108
sp|A1TJR8|GLPK_ACIAC Glycerol kinase OS=Acidovorax citrulli (strain AAC00-1) GN=glpK PE=3 SV=1 3 471 4.0E-108
sp|C3MG71|GLPK_RHISN Glycerol kinase OS=Rhizobium sp. (strain NGR234) GN=glpK PE=3 SV=1 12 469 7.0E-108
sp|Q9HY41|GLPK1_PSEAE Glycerol kinase 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=glpK1 PE=3 SV=1 1 472 7.0E-108
sp|Q0A923|GLPK_ALKEH Glycerol kinase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=glpK PE=3 SV=1 12 476 9.0E-108
sp|Q8TZI8|GLPK_PYRFU Glycerol kinase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=glpK PE=3 SV=1 12 476 1.0E-107
sp|Q047N5|GLPK_LACDB Glycerol kinase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=glpK PE=3 SV=1 12 476 2.0E-107
sp|Q98M73|GLPK_RHILO Glycerol kinase OS=Rhizobium loti (strain MAFF303099) GN=glpK PE=3 SV=1 12 469 2.0E-107
sp|B2RZV0|GLPK_BORHD Glycerol kinase OS=Borrelia hermsii (strain HS1 / DAH) GN=glpK PE=3 SV=1 11 474 4.0E-107
sp|Q6MJQ2|GLPK_BDEBA Glycerol kinase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=glpK PE=3 SV=1 12 469 1.0E-106
sp|A9NCY5|GLPK_COXBR Glycerol kinase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=glpK PE=3 SV=1 12 469 1.0E-106
sp|Q10Y19|GLPK_TRIEI Glycerol kinase OS=Trichodesmium erythraeum (strain IMS101) GN=glpK PE=3 SV=1 12 476 2.0E-106
sp|Q83D14|GLPK_COXBU Glycerol kinase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=glpK PE=3 SV=1 12 469 2.0E-106
sp|A9KCL1|GLPK_COXBN Glycerol kinase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=glpK PE=3 SV=1 12 469 2.0E-106
sp|A9KQC2|GLPK_CLOPH Glycerol kinase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=glpK PE=3 SV=1 12 475 3.0E-106
sp|Q7NJT1|GLPK_GLOVI Glycerol kinase OS=Gloeobacter violaceus (strain PCC 7421) GN=glpK PE=3 SV=1 12 474 3.0E-106
sp|Q2IZ89|GLPK_RHOP2 Glycerol kinase OS=Rhodopseudomonas palustris (strain HaA2) GN=glpK PE=3 SV=1 12 469 5.0E-106
sp|B4S2H6|GLPK_ALTMD Glycerol kinase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=glpK PE=3 SV=1 10 472 5.0E-106
sp|B0SPA9|GLPK_LEPBP Glycerol kinase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=glpK PE=3 SV=1 12 468 8.0E-106
sp|B0SG67|GLPK_LEPBA Glycerol kinase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=glpK PE=3 SV=1 12 468 8.0E-106
sp|A4WRT7|GLPK_RHOS5 Glycerol kinase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=glpK PE=3 SV=1 12 469 2.0E-105
sp|Q0VRN6|GLPK_ALCBS Glycerol kinase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=glpK PE=3 SV=1 9 473 4.0E-105
sp|P75064|GLPK_MYCPN Glycerol kinase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=glpK PE=3 SV=1 12 476 7.0E-105
sp|B9J7X6|GLPK_AGRRK Glycerol kinase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=glpK PE=3 SV=1 12 469 2.0E-104
sp|A4IW85|GLPK_FRATW Glycerol kinase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=glpK PE=3 SV=1 12 475 2.0E-104
sp|O86033|GLPK_RHIME Glycerol kinase OS=Rhizobium meliloti (strain 1021) GN=glpK PE=1 SV=2 12 469 3.0E-104
sp|Q1QVQ3|GLPK_CHRSD Glycerol kinase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=glpK PE=3 SV=1 12 469 3.0E-104
sp|Q5NIE5|GLPK_FRATT Glycerol kinase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=glpK PE=3 SV=1 12 475 3.0E-104
sp|Q14JU8|GLPK_FRAT1 Glycerol kinase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=glpK PE=3 SV=1 12 475 3.0E-104
sp|B2SF32|GLPK_FRATM Glycerol kinase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=glpK PE=3 SV=1 12 475 3.0E-104
sp|A0Q880|GLPK_FRATN Glycerol kinase OS=Francisella tularensis subsp. novicida (strain U112) GN=glpK PE=3 SV=1 12 475 3.0E-104
sp|Q3J317|GLPK_RHOS4 Glycerol kinase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=glpK PE=3 SV=1 12 469 4.0E-104
sp|B3QH88|GLPK_RHOPT Glycerol kinase OS=Rhodopseudomonas palustris (strain TIE-1) GN=glpK PE=3 SV=1 12 469 4.0E-104
sp|Q0BKK9|GLPK_FRATO Glycerol kinase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=glpK PE=3 SV=1 12 475 4.0E-104
sp|Q2A1W9|GLPK_FRATH Glycerol kinase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=glpK PE=3 SV=1 12 475 4.0E-104
sp|A7NE12|GLPK_FRATF Glycerol kinase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=glpK PE=3 SV=1 12 475 4.0E-104
sp|Q8U940|GLPK_AGRFC Glycerol kinase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=glpK PE=3 SV=2 12 439 9.0E-104
sp|B9KRP4|GLPK_RHOSK Glycerol kinase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=glpK PE=3 SV=1 12 469 1.0E-103
sp|Q6MTY7|GLPK_MYCMS Glycerol kinase OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=glpK PE=3 SV=1 10 475 1.0E-103
sp|B6JJF0|GLPK_OLICO Glycerol kinase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=glpK PE=3 SV=1 12 469 2.0E-103
sp|B0CB70|GLPK_ACAM1 Glycerol kinase OS=Acaryochloris marina (strain MBIC 11017) GN=glpK PE=3 SV=1 12 476 2.0E-103
sp|Q6N3I8|GLPK_RHOPA Glycerol kinase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=glpK PE=3 SV=1 12 469 3.0E-103
sp|Q2SSQ8|GLPK_MYCCT Glycerol kinase OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=glpK PE=3 SV=1 10 475 4.0E-103
sp|A3PJB4|GLPK_RHOS1 Glycerol kinase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=glpK PE=3 SV=1 12 469 4.0E-103
sp|Q9HNS5|GLPK_HALSA Glycerol kinase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=glpK PE=3 SV=1 12 475 8.0E-103
sp|B0R6S2|GLPK_HALS3 Glycerol kinase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=glpK PE=3 SV=1 12 475 8.0E-103
sp|A6W2C1|GLPK_MARMS Glycerol kinase OS=Marinomonas sp. (strain MWYL1) GN=glpK PE=3 SV=1 9 472 3.0E-102
sp|A1U326|GLPK_MARHV Glycerol kinase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=glpK PE=3 SV=1 10 469 4.0E-102
sp|A7IJ56|GLPK_XANP2 Glycerol kinase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=glpK PE=3 SV=1 14 469 4.0E-102
sp|Q2RST6|GLPK_RHORT Glycerol kinase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=glpK PE=3 SV=1 3 416 3.0E-101
sp|B8CW97|GLPK_HALOH Glycerol kinase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=glpK PE=3 SV=1 12 475 5.0E-101
sp|B7K2C0|GLPK_CYAP8 Glycerol kinase OS=Cyanothece sp. (strain PCC 8801) GN=glpK PE=3 SV=1 12 476 2.0E-100
sp|Q5FP70|GLPK_GLUOX Glycerol kinase OS=Gluconobacter oxydans (strain 621H) GN=glpK PE=3 SV=1 12 469 2.0E-100
sp|Q5LWR1|GLPK_RUEPO Glycerol kinase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=glpK PE=3 SV=1 2 462 6.0E-99
sp|Q0AEC9|GLPK_NITEC Glycerol kinase OS=Nitrosomonas eutropha (strain C91) GN=glpK PE=3 SV=1 12 469 2.0E-98
sp|Q11HY2|GLPK_CHESB Glycerol kinase OS=Chelativorans sp. (strain BNC1) GN=glpK PE=3 SV=1 12 431 2.0E-98
sp|B9JZR4|GLPK_AGRVS Glycerol kinase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=glpK PE=3 SV=1 12 469 3.0E-98
sp|Q165D5|GLPK_ROSDO Glycerol kinase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=glpK PE=3 SV=1 9 468 5.0E-96
sp|Q891B8|GLPK2_CLOTE Glycerol kinase 2 OS=Clostridium tetani (strain Massachusetts / E88) GN=glpK2 PE=3 SV=1 12 469 4.0E-95
sp|P74260|GLPK_SYNY3 Glycerol kinase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=glpK PE=3 SV=1 12 429 5.0E-94
sp|Q9X049|GLPK1_THEMA Glycerol kinase 1 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=glpK1 PE=3 SV=1 12 469 1.0E-93
sp|A0JPE9|GLPK5_DANRE Putative glycerol kinase 5 OS=Danio rerio GN=gk5 PE=2 SV=1 12 476 7.0E-67
sp|Q8BX05|GLPK5_MOUSE Putative glycerol kinase 5 OS=Mus musculus GN=Gk5 PE=2 SV=2 2 476 3.0E-64
sp|Q6ZS86|GLPK5_HUMAN Putative glycerol kinase 5 OS=Homo sapiens GN=GK5 PE=2 SV=2 2 476 2.0E-60
sp|Q5ZMJ4|GLPK5_CHICK Putative glycerol kinase 5 OS=Gallus gallus GN=GK5 PE=2 SV=1 12 474 6.0E-58
sp|Q08D86|GLPK5_BOVIN Putative glycerol kinase 5 OS=Bos taurus GN=GK5 PE=2 SV=1 12 474 1.0E-54
sp|Q6GP95|GLPK5_XENLA Putative glycerol kinase 5 OS=Xenopus laevis GN=gk5 PE=2 SV=1 14 427 6.0E-53
sp|O29395|Y866_ARCFU Uncharacterized sugar kinase AF_0866 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_0866 PE=3 SV=1 12 472 1.0E-46
sp|Q9CFG8|XYLB_LACLA Xylulose kinase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=xylB PE=3 SV=1 12 470 2.0E-23
sp|P12011|GNTK_BACSU Gluconokinase OS=Bacillus subtilis (strain 168) GN=gntK PE=3 SV=1 9 440 2.0E-23
sp|P37677|LYXK_ECOLI L-xylulose/3-keto-L-gulonate kinase OS=Escherichia coli (strain K12) GN=lyx PE=1 SV=1 12 474 4.0E-22
sp|P46834|GNTK_BACLI Gluconokinase OS=Bacillus licheniformis GN=gntK PE=3 SV=1 9 440 3.0E-21
sp|P35850|XYLB_LACBR Xylulose kinase OS=Lactobacillus brevis GN=xylB PE=2 SV=2 7 451 3.0E-17
sp|P39211|XYLB_BACSU Xylulose kinase OS=Bacillus subtilis (strain 168) GN=xylB PE=3 SV=2 2 451 5.0E-16
sp|P21939|XYLB_LACPE Xylulose kinase OS=Lactobacillus pentosus GN=xylB PE=3 SV=1 2 468 2.0E-15
sp|P27155|XYLB_STAXY Xylulose kinase OS=Staphylococcus xylosus GN=xylB PE=3 SV=1 34 439 4.0E-14
sp|Q5HL88|XYLB_STAEQ D-xylulose kinase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=xylB PE=3 SV=1 7 451 3.0E-13
sp|Q8CR47|XYLB_STAES D-xylulose kinase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=xylB PE=3 SV=1 7 451 3.0E-13
sp|A1JJ57|LSRK_YERE8 Autoinducer-2 kinase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=lsrK PE=3 SV=2 45 456 8.0E-12
sp|Q8ZKQ6|LSRK_SALTY Autoinducer-2 kinase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=lsrK PE=1 SV=1 48 472 2.0E-10
sp|Q57HE4|LSRK_SALCH Autoinducer-2 kinase OS=Salmonella choleraesuis (strain SC-B67) GN=lsrK PE=3 SV=1 48 472 2.0E-10
sp|A9MZF8|LSRK_SALPB Autoinducer-2 kinase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=lsrK PE=3 SV=1 48 472 2.0E-10
sp|P55138|YGCE_ECOLI Uncharacterized sugar kinase YgcE OS=Escherichia coli (strain K12) GN=ygcE PE=3 SV=2 316 468 3.0E-10
sp|Q5PJE9|LSRK_SALPA Autoinducer-2 kinase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=lsrK PE=3 SV=1 48 472 3.0E-10
sp|Q8Z2X3|LSRK_SALTI Autoinducer-2 kinase OS=Salmonella typhi GN=lsrK PE=3 SV=1 48 472 3.0E-10
sp|A7ZLW9|LSRK_ECO24 Autoinducer-2 kinase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=lsrK PE=3 SV=1 35 436 5.0E-10
sp|P77432|LSRK_ECOLI Autoinducer-2 kinase OS=Escherichia coli (strain K12) GN=lsrK PE=1 SV=1 35 436 5.0E-10
sp|B1XE99|LSRK_ECODH Autoinducer-2 kinase OS=Escherichia coli (strain K12 / DH10B) GN=lsrK PE=3 SV=1 35 436 5.0E-10
sp|B1LFA4|LSRK_ECOSM Autoinducer-2 kinase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=lsrK PE=3 SV=1 108 436 7.0E-10
sp|B1IRU9|LSRK_ECOLC Autoinducer-2 kinase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=lsrK PE=3 SV=1 35 436 1.0E-09
sp|A8A064|LSRK_ECOHS Autoinducer-2 kinase OS=Escherichia coli O9:H4 (strain HS) GN=lsrK PE=3 SV=1 35 436 4.0E-09
sp|P09099|XYLB_ECOLI Xylulose kinase OS=Escherichia coli (strain K12) GN=xylB PE=1 SV=1 12 437 7.0E-09
sp|P29444|XYLB_KLEPN Xylulose kinase OS=Klebsiella pneumoniae GN=xylB PE=3 SV=1 12 427 3.0E-08
sp|Q5WL06|ARAB_BACSK Ribulokinase OS=Bacillus clausii (strain KSM-K16) GN=araB PE=3 SV=1 326 429 6.0E-08
sp|P12867|XYLB_ACTM4 Xylulose kinase OS=Actinoplanes missouriensis (strain ATCC 14538 / DSM 43046 / CBS 188.64 / JCM 3121 / NCIMB 12654 / NBRC 102363 / 431) GN=xylB PE=3 SV=3 44 421 9.0E-08
sp|P94524|ARAB_BACSU Ribulokinase OS=Bacillus subtilis (strain 168) GN=araB PE=2 SV=1 73 437 1.0E-07
sp|Q9RK00|XYLB_STRCO Xylulose kinase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=xylB PE=3 SV=2 39 414 3.0E-07
sp|Q9KBQ3|ARAB_BACHD Ribulokinase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=araB PE=1 SV=1 326 429 4.0E-07
sp|A2AJL3|FGGY_MOUSE FGGY carbohydrate kinase domain-containing protein OS=Mus musculus GN=Fggy PE=1 SV=1 325 475 4.0E-07
sp|Q6NUW9|FGGY_DANRE FGGY carbohydrate kinase domain-containing protein OS=Danio rerio GN=fggy PE=2 SV=2 325 460 2.0E-06
sp|Q9S468|ARAB_GEOSE Ribulokinase OS=Geobacillus stearothermophilus GN=araB PE=3 SV=1 1 415 7.0E-06
sp|P27156|XYLB_STRRU Xylulose kinase OS=Streptomyces rubiginosus GN=xylB PE=3 SV=1 39 243 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016773 phosphotransferase activity, alcohol group as acceptor Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10024
LRVANAQRDDSWHEHDPEELISSVHACIDGAVAKFETQGHSRAQIVAVGITNQRETTVVWDRTTGKALHNAIVWT
DTRSQDLVRRLKTRIGAGELTQRCGLPLSTYPSVSKLLWLLEQVPAVKEAYERGELAFGTVDTWLAYKLNGGPAR
NVYVSDPSNASRTMFMNLRTLDYDDELLDWFRLDRDKVLLPKIVRSADAEQYGSLAETALRGTRITGCLGDQSAA
LVGQKGFTPGLAKNTYGTGCFLLYNVGAEPVVSSHGLLTTVAFDFGEGKRMYALEGSIAVAGSSVKFLVDNFGFI
ESSAKLSALAETVEDNGGCTFVTAFSGLFAPYWIDDARGTIFGITAYTQRGHIARATLEATCFQTKAILDSMEKD
SGQALTELAVDGGMCNADLVMQTQADIIGIPVNRPAMRETTALGAAIAAGLAAGVWGSFDELADVNVEGRTVFRP
KIGTEAAARRFERWEKAVQMSRGWAN*
Coding >Hirsu2|10024
CTGCGGGTCGCTAATGCGCAACGCGACGACAGCTGGCATGAGCACGACCCCGAGGAGCTCATCTCGTCGGTGCAC
GCGTGCATCGACGGAGCCGTGGCCAAGTTCGAGACGCAGGGCCACTCGCGGGCGCAGATCGTGGCCGTCGGCATC
ACCAACCAGCGCGAGACGACGGTGGTGTGGGACAGGACGACGGGCAAGGCGCTGCACAACGCCATCGTCTGGACC
GACACGCGGTCGCAGGACCTGGTGCGGCGGCTCAAGACGCGGATCGGGGCGGGCGAGCTGACGCAGCGCTGCGGA
CTGCCGCTGTCGACGTACCCGTCGGTCAGCAAGCTGCTCTGGCTGCTGGAGCAGGTGCCGGCCGTCAAGGAGGCG
TACGAGCGCGGCGAGCTGGCCTTTGGCACCGTCGACACCTGGCTGGCCTACAAGCTCAACGGCGGGCCGGCGCGC
AACGTGTACGTGTCGGACCCGTCCAACGCGTCGCGGACCATGTTCATGAACCTGCGCACGCTCGACTACGACGAC
GAGCTGCTGGACTGGTTCCGACTGGACCGCGACAAGGTGCTGCTGCCCAAGATCGTGCGGTCGGCGGACGCGGAG
CAGTACGGGTCGCTGGCGGAGACGGCGCTGCGCGGGACGCGGATCACGGGCTGCCTGGGGGACCAGTCGGCGGCG
CTGGTGGGCCAGAAGGGCTTCACGCCGGGGCTGGCCAAGAACACGTACGGCACCGGCTGCTTCCTGCTGTACAAC
GTGGGCGCGGAGCCGGTGGTGTCGTCGCACGGGCTGCTGACGACGGTCGCCTTTGACTTCGGCGAGGGCAAGCGC
ATGTACGCGCTCGAGGGAAGCATCGCGGTGGCCGGGTCGAGCGTCAAGTTCCTCGTCGACAACTTTGGCTTCATC
GAGTCGAGCGCGAAGCTGAGCGCGCTGGCGGAGACGGTCGAGGACAACGGCGGGTGCACGTTCGTGACGGCCTTT
AGCGGGCTGTTCGCGCCGTACTGGATCGACGACGCGCGCGGCACCATCTTCGGCATCACGGCCTACACGCAGCGC
GGGCACATTGCGCGGGCGACGCTGGAGGCGACGTGCTTCCAGACCAAGGCGATCCTGGACTCGATGGAGAAGGAC
AGCGGGCAGGCGCTGACGGAGCTGGCGGTGGACGGCGGCATGTGCAACGCCGACCTCGTCATGCAGACGCAGGCG
GACATTATTGGCATCCCGGTCAACCGGCCGGCGATGCGGGAGACGACGGCGCTGGGGGCGGCGATTGCGGCCGGG
CTGGCGGCCGGGGTGTGGGGGTCCTTTGACGAGCTGGCGGACGTCAACGTGGAGGGGCGGACGGTGTTCCGGCCC
AAGATCGGGACGGAGGCGGCGGCGCGGCGGTTCGAGCGGTGGGAGAAGGCGGTGCAGATGAGCCGGGGCTGGGCC
AACTAG
Transcript >Hirsu2|10024
CTGCGGGTCGCTAATGCGCAACGCGACGACAGCTGGCATGAGCACGACCCCGAGGAGCTCATCTCGTCGGTGCAC
GCGTGCATCGACGGAGCCGTGGCCAAGTTCGAGACGCAGGGCCACTCGCGGGCGCAGATCGTGGCCGTCGGCATC
ACCAACCAGCGCGAGACGACGGTGGTGTGGGACAGGACGACGGGCAAGGCGCTGCACAACGCCATCGTCTGGACC
GACACGCGGTCGCAGGACCTGGTGCGGCGGCTCAAGACGCGGATCGGGGCGGGCGAGCTGACGCAGCGCTGCGGA
CTGCCGCTGTCGACGTACCCGTCGGTCAGCAAGCTGCTCTGGCTGCTGGAGCAGGTGCCGGCCGTCAAGGAGGCG
TACGAGCGCGGCGAGCTGGCCTTTGGCACCGTCGACACCTGGCTGGCCTACAAGCTCAACGGCGGGCCGGCGCGC
AACGTGTACGTGTCGGACCCGTCCAACGCGTCGCGGACCATGTTCATGAACCTGCGCACGCTCGACTACGACGAC
GAGCTGCTGGACTGGTTCCGACTGGACCGCGACAAGGTGCTGCTGCCCAAGATCGTGCGGTCGGCGGACGCGGAG
CAGTACGGGTCGCTGGCGGAGACGGCGCTGCGCGGGACGCGGATCACGGGCTGCCTGGGGGACCAGTCGGCGGCG
CTGGTGGGCCAGAAGGGCTTCACGCCGGGGCTGGCCAAGAACACGTACGGCACCGGCTGCTTCCTGCTGTACAAC
GTGGGCGCGGAGCCGGTGGTGTCGTCGCACGGGCTGCTGACGACGGTCGCCTTTGACTTCGGCGAGGGCAAGCGC
ATGTACGCGCTCGAGGGAAGCATCGCGGTGGCCGGGTCGAGCGTCAAGTTCCTCGTCGACAACTTTGGCTTCATC
GAGTCGAGCGCGAAGCTGAGCGCGCTGGCGGAGACGGTCGAGGACAACGGCGGGTGCACGTTCGTGACGGCCTTT
AGCGGGCTGTTCGCGCCGTACTGGATCGACGACGCGCGCGGCACCATCTTCGGCATCACGGCCTACACGCAGCGC
GGGCACATTGCGCGGGCGACGCTGGAGGCGACGTGCTTCCAGACCAAGGCGATCCTGGACTCGATGGAGAAGGAC
AGCGGGCAGGCGCTGACGGAGCTGGCGGTGGACGGCGGCATGTGCAACGCCGACCTCGTCATGCAGACGCAGGCG
GACATTATTGGCATCCCGGTCAACCGGCCGGCGATGCGGGAGACGACGGCGCTGGGGGCGGCGATTGCGGCCGGG
CTGGCGGCCGGGGTGTGGGGGTCCTTTGACGAGCTGGCGGACGTCAACGTGGAGGGGCGGACGGTGTTCCGGCCC
AAGATCGGGACGGAGGCGGCGGCGCGGCGGTTCGAGCGGTGGGAGAAGGCGGTGCAGATGAGCCGGGGCTGGGCC
AACTAG
Gene >Hirsu2|10024
CTGCGGGTCGCTAATGCGCAACGCGACGACAGCTGGCATGAGCACGACCCCGAGGAGCTCATCTCGTCGGTGCAC
GCGTGCATCGACGGAGCCGTGGCCAAGTTCGAGACGCAGGGCCACTCGCGGGCGCAGATCGTGGCCGTCGGCATC
ACCAACCAGCGCGAGACGACGGTGGTGTGGGACAGGACGACGGGCAAGGCGCTGCACAACGCCATCGTCTGGACC
GACACGCGGTCGCAGGACCTGGTGCGGCGGCTCAAGACGCGGATCGGGGCGGGCGAGCTGACGCAGCGCTGCGGA
CTGCCGCTGTCGACGTACCCGTCGGTCAGCAAGCTGCTCTGGCTGCTGGAGCAGGTGCCGGCCGTCAAGGAGGCG
TACGAGCGCGGCGAGCTGGCCTTTGGCACCGTCGACACCTGGCTGGCCTACAAGCTCAACGGCGGGCCGGCGCGC
AACGTGTACGTGTCGGACCCGTCCAACGCGTCGCGGACCATGTTCATGAACCTGCGCACGCTCGACTACGACGAC
GAGCTGCTGGACTGGTTCCGACTGGACCGCGACAAGGTGCTGCTGCCCAAGATCGTGCGGTCGGCGGACGCGGAG
CAGTACGGGTCGCTGGCGGAGACGGCGCTGCGCGGGACGCGGATCACGGGCTGCCTGGGGGACCAGTCGGCGGCG
CTGGTGGGCCAGAAGGGCTTCACGCCGGGGCTGGCCAAGAACACGTACGGCACCGGCTGCTTCCTGCTGTACAAC
GTGGGCGCGGAGCCGGTGGTGTCGTCGCACGGGCTGCTGACGACGGTCGCCTTTGACTTCGGCGAGGGCAAGCGC
ATGTACGCGCTCGAGGGAAGCATCGCGGTGGCCGGGTCGAGCGTCAAGTTCCTCGTCGACAACTTTGGCTTCATC
GAGTCGAGCGCGAAGCTGAGCGCGCTGGCGGAGACGGTCGAGGACAACGGCGGGTGCACGTTCGTGACGGCCTTT
AGCGGGCTGTTCGCGCCGTACTGGATCGACGACGCGCGCGGCACCATCTTCGGCATCACGGCCTACACGCAGCGC
GGGCACATTGCGCGGGCGACGCTGGAGGCGACGTGCTTCCAGACCAAGGCGATCCTGGACTCGATGGAGAAGGAC
AGCGGGCAGGCGCTGACGGAGCTGGCGGTGGACGGCGGCATGTGCAACGCCGACCTCGTCATGCAGGTGAGTTGG
CGTGCACGAGGGAGCCTCGGGTGGTGGCGTTGCCCGGCTGACGGTTGCGGCAGACGCAGGCGGACATTATTGGCA
TCCCGGTCAACCGGCCGGCGATGCGGGAGACGACGGCGCTGGGGGCGGCGATTGCGGCCGGGCTGGCGGCCGGGG
TGTGGGGGTCCTTTGACGAGCTGGCGGACGTCAACGTGGAGGGGCGGACGGTGTTCCGGCCCAAGATCGGGACGG
AGGCGGCGGCGCGGCGGTTCGAGCGGTGGGAGAAGGCGGTGCAGATGAGCCGGGGCTGGGCCAACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail