Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10016
Gene name
LocationContig_775:9686..10355
Strand-
Gene length (bp)669
Transcript length (bp)669
Coding sequence length (bp)669
Protein length (aa) 223

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain 3.9E-10 67 138
PF00501 AMP-binding AMP-binding enzyme 6.5E-09 12 58

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8J0E9|CEFD1_ACRCH Isopenicillin N epimerase component 1 OS=Acremonium chrysogenum GN=cefD1 PE=3 SV=1 15 215 1.0E-40
sp|O42633|FAT1_COCHE Fatty acid transporter protein OS=Cochliobolus heterostrophus GN=FAT1 PE=3 SV=1 4 222 7.0E-38
sp|O14975|S27A2_HUMAN Very long-chain acyl-CoA synthetase OS=Homo sapiens GN=SLC27A2 PE=1 SV=2 13 222 5.0E-33
sp|Q5K4L6|S27A3_HUMAN Long-chain fatty acid transport protein 3 OS=Homo sapiens GN=SLC27A3 PE=2 SV=3 13 162 2.0E-32
sp|Q9Y2P4|S27A6_HUMAN Long-chain fatty acid transport protein 6 OS=Homo sapiens GN=SLC27A6 PE=2 SV=1 1 162 6.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8J0E9|CEFD1_ACRCH Isopenicillin N epimerase component 1 OS=Acremonium chrysogenum GN=cefD1 PE=3 SV=1 15 215 1.0E-40
sp|O42633|FAT1_COCHE Fatty acid transporter protein OS=Cochliobolus heterostrophus GN=FAT1 PE=3 SV=1 4 222 7.0E-38
sp|O14975|S27A2_HUMAN Very long-chain acyl-CoA synthetase OS=Homo sapiens GN=SLC27A2 PE=1 SV=2 13 222 5.0E-33
sp|Q5K4L6|S27A3_HUMAN Long-chain fatty acid transport protein 3 OS=Homo sapiens GN=SLC27A3 PE=2 SV=3 13 162 2.0E-32
sp|Q9Y2P4|S27A6_HUMAN Long-chain fatty acid transport protein 6 OS=Homo sapiens GN=SLC27A6 PE=2 SV=1 1 162 6.0E-32
sp|P97524|S27A2_RAT Very long-chain acyl-CoA synthetase OS=Rattus norvegicus GN=Slc27a2 PE=1 SV=1 16 222 8.0E-32
sp|O35488|S27A2_MOUSE Very long-chain acyl-CoA synthetase OS=Mus musculus GN=Slc27a2 PE=1 SV=2 16 162 4.0E-31
sp|Q6P1M0|S27A4_HUMAN Long-chain fatty acid transport protein 4 OS=Homo sapiens GN=SLC27A4 PE=1 SV=1 10 222 5.0E-31
sp|Q5RDY4|S27A4_PONAB Long-chain fatty acid transport protein 4 OS=Pongo abelii GN=SLC27A4 PE=2 SV=1 10 222 1.0E-30
sp|O88561|S27A3_MOUSE Long-chain fatty acid transport protein 3 OS=Mus musculus GN=Slc27a3 PE=1 SV=2 13 162 2.0E-30
sp|Q4R3Y4|S27A4_MACFA Long-chain fatty acid transport protein 4 OS=Macaca fascicularis GN=SLC27A4 PE=2 SV=2 10 168 4.0E-29
sp|Q91VE0|S27A4_MOUSE Long-chain fatty acid transport protein 4 OS=Mus musculus GN=Slc27a4 PE=1 SV=1 10 168 5.0E-29
sp|Q60714|S27A1_MOUSE Long-chain fatty acid transport protein 1 OS=Mus musculus GN=Slc27a1 PE=1 SV=1 10 165 1.0E-25
sp|Q3ZKN0|S27A1_BOVIN Long-chain fatty acid transport protein 1 OS=Bos taurus GN=SLC27A1 PE=2 SV=1 10 165 7.0E-25
sp|P97849|S27A1_RAT Long-chain fatty acid transport protein 1 OS=Rattus norvegicus GN=Slc27a1 PE=2 SV=1 10 165 2.0E-24
sp|Q6PCB7|S27A1_HUMAN Long-chain fatty acid transport protein 1 OS=Homo sapiens GN=SLC27A1 PE=2 SV=1 10 165 2.0E-24
sp|P38225|FAT1_YEAST Very long-chain fatty acid transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAT1 PE=1 SV=2 16 163 2.0E-24
sp|Q9Y2P5|S27A5_HUMAN Bile acyl-CoA synthetase OS=Homo sapiens GN=SLC27A5 PE=1 SV=1 19 163 4.0E-24
sp|Q9ES38|S27A5_RAT Bile acyl-CoA synthetase OS=Rattus norvegicus GN=Slc27a5 PE=1 SV=1 16 163 6.0E-24
sp|Q4LDG0|S27A5_MOUSE Bile acyl-CoA synthetase OS=Mus musculus GN=Slc27a5 PE=1 SV=2 14 163 1.0E-23
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 16 155 8.0E-10
sp|Q9FFE9|AAE6_ARATH Probable acyl-activating enzyme 6 OS=Arabidopsis thaliana GN=AAE6 PE=2 SV=1 31 163 2.0E-09
sp|A0R5G1|ACSA_MYCS2 Acetyl-coenzyme A synthetase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=acsA PE=3 SV=1 31 157 2.0E-09
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 13 138 2.0E-09
sp|Q9SEY5|AAE2_ARATH Probable acyl-activating enzyme 2 OS=Arabidopsis thaliana GN=AAE2 PE=2 SV=1 31 156 4.0E-09
sp|Q9LQS1|AAE8_ARATH Probable acyl-activating enzyme 8 OS=Arabidopsis thaliana GN=AAE8 PE=2 SV=1 22 157 4.0E-09
sp|Q9LPK6|AEE9_ARATH Probable acyl-activating enzyme 9 OS=Arabidopsis thaliana GN=AEE9 PE=2 SV=1 10 157 6.0E-09
sp|Q9FFE6|AAE5_ARATH Probable acyl-activating enzyme 5, peroxisomal OS=Arabidopsis thaliana GN=AAE5 PE=2 SV=1 31 165 7.0E-09
sp|Q8VZF1|AEE7_ARATH Acetate/butyrate--CoA ligase AAE7, peroxisomal OS=Arabidopsis thaliana GN=AAE7 PE=1 SV=1 31 166 2.0E-08
sp|O80658|AAE4_ARATH Probable acyl-activating enzyme 4 OS=Arabidopsis thaliana GN=AEE4 PE=2 SV=1 10 157 3.0E-08
sp|P86831|CBCL1_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 4 86 3.0E-08
sp|P86832|CBCL2_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 4 86 3.0E-08
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 12 132 4.0E-08
sp|F4HUK6|AAE1_ARATH Probable acyl-activating enzyme 1, peroxisomal OS=Arabidopsis thaliana GN=AAE1 PE=2 SV=1 22 156 5.0E-08
sp|Q5SKN9|LCFCS_THET8 Long-chain-fatty-acid--CoA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA0604 PE=1 SV=1 29 90 5.0E-08
sp|Q9LPK7|AEE10_ARATH Probable acyl-activating enzyme 10 OS=Arabidopsis thaliana GN=AEE10 PE=2 SV=1 10 157 6.0E-08
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 12 144 1.0E-07
sp|Q1AXQ5|ACSA_RUBXD Acetyl-coenzyme A synthetase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=acsA PE=3 SV=1 28 156 1.0E-07
sp|Q9C9G2|AEE22_ARATH Probable acyl-activating enzyme 22 OS=Arabidopsis thaliana GN=AEE22 PE=3 SV=1 8 139 3.0E-07
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 12 83 4.0E-07
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 12 83 4.0E-07
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 12 132 5.0E-07
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 12 132 5.0E-07
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 12 132 6.0E-07
sp|Q9SS01|AAE20_ARATH Benzoate--CoA ligase, peroxisomal OS=Arabidopsis thaliana GN=AAE20 PE=1 SV=1 8 139 6.0E-07
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 12 132 8.0E-07
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 12 129 8.0E-07
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 29 138 9.0E-07
sp|Q7XXL2|4CLL9_ORYSJ 4-coumarate--CoA ligase-like 9 OS=Oryza sativa subsp. japonica GN=4CLL9 PE=2 SV=2 28 161 1.0E-06
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 12 132 2.0E-06
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 6 83 2.0E-06
sp|A9IYZ3|ACSA_BART1 Acetyl-coenzyme A synthetase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=acsA PE=3 SV=1 32 138 3.0E-06
sp|B7KPN8|ACSA_METC4 Acetyl-coenzyme A synthetase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=acsA PE=3 SV=1 29 136 3.0E-06
sp|Q7F1X5|4CLL5_ORYSJ 4-coumarate--CoA ligase-like 5 OS=Oryza sativa subsp. japonica GN=4CLL5 PE=2 SV=1 31 128 3.0E-06
sp|P59872|ACSA_RHOBA Acetyl-coenzyme A synthetase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=acsA PE=3 SV=1 32 157 3.0E-06
sp|A9W5V0|ACSA_METEP Acetyl-coenzyme A synthetase OS=Methylobacterium extorquens (strain PA1) GN=acsA PE=3 SV=1 29 136 3.0E-06
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 29 157 3.0E-06
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 12 138 4.0E-06
sp|C1AA44|ACSA_GEMAT Acetyl-coenzyme A synthetase OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=acsA PE=3 SV=1 35 157 5.0E-06
sp|Q5LRT0|DMDB_RUEPO 3-methylmercaptopropionyl-CoA ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dmdB PE=1 SV=1 29 157 6.0E-06
sp|Q1QEB6|ACSA_PSYCK Acetyl-coenzyme A synthetase OS=Psychrobacter cryohalolentis (strain K5) GN=acsA PE=3 SV=1 18 123 7.0E-06
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 10 157 7.0E-06
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 12 129 8.0E-06
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 12 131 8.0E-06
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 16 203 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10016
LHRAHASSTFFKPAATAAKLLRDVFRPGDVWFRTGDVVRWDADGRVFFSDRIGDTFRWKSENVSTVEVSQALGLH
PAVREANVYGVALPHHDGRAGCAAVCFDPSPPGPDVLRSLADHVRARLPRYARPLFLRLVPEVGADGQTTGTNKQ
QKHLLRDAGVRPGPTPCPAPPPPDSGAASGPTPDTTTTATTATTDMYWLHGDSYVPFRQDDYNALEAGRVKL*
Coding >Hirsu2|10016
CTGCATCGCGCCCATGCATCGTCGACCTTCTTCAAGCCCGCCGCCACCGCCGCCAAGCTGCTGCGCGACGTCTTC
CGCCCCGGCGACGTCTGGTTCCGCACCGGCGACGTCGTCCGCTGGGACGCCGACGGCCGCGTCTTTTTCTCCGAC
CGCATCGGCGACACCTTCCGCTGGAAGTCGGAGAACGTCTCGACCGTCGAGGTCAGCCAGGCCCTCGGCCTGCAC
CCGGCCGTCCGCGAGGCCAACGTCTACGGCGTCGCCCTGCCCCACCACGACGGCCGCGCCGGCTGCGCCGCCGTC
TGCTTCGACCCGAGCCCCCCCGGCCCGGATGTCCTCCGCTCCCTCGCCGACCACGTCCGTGCCCGCCTGCCGCGC
TACGCCCGCCCGCTCTTCCTGCGCCTCGTCCCGGAGGTCGGCGCCGACGGCCAGACCACCGGCACCAACAAGCAG
CAGAAGCACCTCCTGCGCGACGCCGGCGTCCGCCCGGGACCCACCCCCTGCCCGGCCCCGCCACCCCCGGACTCC
GGAGCCGCCTCCGGTCCGACCCCGGACACCACCACTACCGCCACCACCGCCACCACCGACATGTATTGGCTCCAC
GGCGACTCCTACGTCCCCTTCCGCCAAGACGACTACAACGCCCTCGAGGCCGGTCGCGTCAAGCTCTGA
Transcript >Hirsu2|10016
CTGCATCGCGCCCATGCATCGTCGACCTTCTTCAAGCCCGCCGCCACCGCCGCCAAGCTGCTGCGCGACGTCTTC
CGCCCCGGCGACGTCTGGTTCCGCACCGGCGACGTCGTCCGCTGGGACGCCGACGGCCGCGTCTTTTTCTCCGAC
CGCATCGGCGACACCTTCCGCTGGAAGTCGGAGAACGTCTCGACCGTCGAGGTCAGCCAGGCCCTCGGCCTGCAC
CCGGCCGTCCGCGAGGCCAACGTCTACGGCGTCGCCCTGCCCCACCACGACGGCCGCGCCGGCTGCGCCGCCGTC
TGCTTCGACCCGAGCCCCCCCGGCCCGGATGTCCTCCGCTCCCTCGCCGACCACGTCCGTGCCCGCCTGCCGCGC
TACGCCCGCCCGCTCTTCCTGCGCCTCGTCCCGGAGGTCGGCGCCGACGGCCAGACCACCGGCACCAACAAGCAG
CAGAAGCACCTCCTGCGCGACGCCGGCGTCCGCCCGGGACCCACCCCCTGCCCGGCCCCGCCACCCCCGGACTCC
GGAGCCGCCTCCGGTCCGACCCCGGACACCACCACTACCGCCACCACCGCCACCACCGACATGTATTGGCTCCAC
GGCGACTCCTACGTCCCCTTCCGCCAAGACGACTACAACGCCCTCGAGGCCGGTCGCGTCAAGCTCTGA
Gene >Hirsu2|10016
CTGCATCGCGCCCATGCATCGTCGACCTTCTTCAAGCCCGCCGCCACCGCCGCCAAGCTGCTGCGCGACGTCTTC
CGCCCCGGCGACGTCTGGTTCCGCACCGGCGACGTCGTCCGCTGGGACGCCGACGGCCGCGTCTTTTTCTCCGAC
CGCATCGGCGACACCTTCCGCTGGAAGTCGGAGAACGTCTCGACCGTCGAGGTCAGCCAGGCCCTCGGCCTGCAC
CCGGCCGTCCGCGAGGCCAACGTCTACGGCGTCGCCCTGCCCCACCACGACGGCCGCGCCGGCTGCGCCGCCGTC
TGCTTCGACCCGAGCCCCCCCGGCCCGGATGTCCTCCGCTCCCTCGCCGACCACGTCCGTGCCCGCCTGCCGCGC
TACGCCCGCCCGCTCTTCCTGCGCCTCGTCCCGGAGGTCGGCGCCGACGGCCAGACCACCGGCACCAACAAGCAG
CAGAAGCACCTCCTGCGCGACGCCGGCGTCCGCCCGGGACCCACCCCCTGCCCGGCCCCGCCACCCCCGGACTCC
GGAGCCGCCTCCGGTCCGACCCCGGACACCACCACTACCGCCACCACCGCCACCACCGACATGTATTGGCTCCAC
GGCGACTCCTACGTCCCCTTCCGCCAAGACGACTACAACGCCCTCGAGGCCGGTCGCGTCAAGCTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail