Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10011
Gene name
LocationContig_774:11665..12272
Strand+
Gene length (bp)607
Transcript length (bp)267
Coding sequence length (bp)267
Protein length (aa) 89

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08227 DASH_Hsk3 DASH complex subunit Hsk3 like 2.6E-19 26 70

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94483|HOS3_SCHPO High osmolarity sensitivity protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hos3 PE=1 SV=1 24 86 9.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10011
MATRNVNATQSLGRHGVAPQGGVVKARQLAHLHAQLARLSANLSDTENLVRMTGVQAEAMRGLGSWHAGLFMAAS
KVLGEESVREADG*
Coding >Hirsu2|10011
ATGGCGACGCGCAACGTCAACGCGACGCAGAGCCTTGGGCGGCATGGCGTGGCGCCGCAGGGGGGGGTTGTTAAG
GCGCGGCAGTTGGCGCATCTGCACGCTCAGCTGGCGCGGCTGTCGGCCAACCTGTCCGACACGGAGAACCTGGTG
CGGATGACGGGCGTGCAGGCCGAGGCGATGAGGGGGCTGGGGAGCTGGCACGCTGGCCTCTTCATGGCGGCGAGC
AAGGTGCTCGGGGAGGAGAGCGTGAGGGAGGCGGACGGGTGA
Transcript >Hirsu2|10011
ATGGCGACGCGCAACGTCAACGCGACGCAGAGCCTTGGGCGGCATGGCGTGGCGCCGCAGGGGGGGGTTGTTAAG
GCGCGGCAGTTGGCGCATCTGCACGCTCAGCTGGCGCGGCTGTCGGCCAACCTGTCCGACACGGAGAACCTGGTG
CGGATGACGGGCGTGCAGGCCGAGGCGATGAGGGGGCTGGGGAGCTGGCACGCTGGCCTCTTCATGGCGGCGAGC
AAGGTGCTCGGGGAGGAGAGCGTGAGGGAGGCGGACGGGTGA
Gene >Hirsu2|10011
ATGGCGACGCGCAACGTCAACGCGACGCAGAGCCTTGGGCGGCATGGCGTGGCGCCGCAGGGGGGGGTTGTTAAG
GCGCGGCAGTTGGTGCGTGGCTCTTACGATGCATACACCGACACAGACATACACACACACACACACACGCACACG
TACAACACACATATATATGGTTATGGATACGGATGAACGGGTGAACTGACGCGCGCAACAGGCGCATCTGCACGC
TCAGCTGGCGCGGCTGTCGGCCAACCTGTCCGACACGGAGAACCTGGTGCGGATGACGGGCGTGCAGGCCGAGGC
GATGAGGGGGCTGGGGAGCTGGCACGCTGGCCTGTGAGCTTGACCTTTTCTTTCTGCCTTGCGCTACCCTACTCT
GCTCCCCTGCCTTGCTTGACTCGCCTTGTCTGCTTTTTCCGCCTGGCTTGACGCGACTCTGCTTTTTTCCCGCCC
TTCTTGACTCGACTCTGCTTCATCTTGCTGGACTCGACTCTGGCTTGCGTTGCCGGACGCTGCTTCTTCCGGGCT
GTCGCGCTGACGCGGCGGCTGTAGCTTCATGGCGGCGAGCAAGGTGCTCGGGGAGGAGAGCGTGAGGGAGGCGGA
CGGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail