Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1000
Gene name
LocationContig_1207:210..2085
Strand-
Gene length (bp)1875
Transcript length (bp)1557
Coding sequence length (bp)1557
Protein length (aa) 519

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00120 Gln-synt_C Glutamine synthetase, catalytic domain 1.3E-85 157 514

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0C7B6|GLNA2_DICDI Type-1 glutamine synthetase 2 OS=Dictyostelium discoideum GN=glnA2 PE=1 SV=1 60 518 1.0E-104
sp|Q936T0|IPUC_PSESP Glutamate--isopropylamine ligase OS=Pseudomonas sp. GN=ipuC PE=1 SV=1 60 518 1.0E-65
sp|P36205|GLNA_THEMA Glutamine synthetase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=glnA PE=3 SV=2 45 515 1.0E-44
sp|Q9UY99|GLNA_PYRAB Glutamine synthetase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=glnA PE=3 SV=1 60 515 2.0E-44
sp|P43386|GLNA_HALVD Glutamine synthetase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=glnA PE=3 SV=2 120 517 2.0E-43
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0C7B6|GLNA2_DICDI Type-1 glutamine synthetase 2 OS=Dictyostelium discoideum GN=glnA2 PE=1 SV=1 60 518 1.0E-104
sp|Q936T0|IPUC_PSESP Glutamate--isopropylamine ligase OS=Pseudomonas sp. GN=ipuC PE=1 SV=1 60 518 1.0E-65
sp|P36205|GLNA_THEMA Glutamine synthetase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=glnA PE=3 SV=2 45 515 1.0E-44
sp|Q9UY99|GLNA_PYRAB Glutamine synthetase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=glnA PE=3 SV=1 60 515 2.0E-44
sp|P43386|GLNA_HALVD Glutamine synthetase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=glnA PE=3 SV=2 120 517 2.0E-43
sp|P10656|GLNA_CLOSA Glutamine synthetase OS=Clostridium saccharobutylicum GN=glnA PE=3 SV=1 120 515 6.0E-43
sp|P36687|GLNA_PYRWO Glutamine synthetase 1 OS=Pyrococcus woesei GN=glnA PE=3 SV=1 60 515 1.0E-42
sp|Q05907|GLNA_PYRFU Glutamine synthetase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=glnA PE=3 SV=2 60 515 3.0E-42
sp|P19064|GLNA_BACCE Glutamine synthetase OS=Bacillus cereus GN=glnA PE=1 SV=3 120 515 2.0E-41
sp|O08467|GLNA_THEKO Glutamine synthetase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=glnA PE=1 SV=2 62 515 2.0E-41
sp|O58097|GLNA_PYRHO Glutamine synthetase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=glnA PE=3 SV=1 55 515 1.0E-39
sp|P12425|GLNA_BACSU Glutamine synthetase OS=Bacillus subtilis (strain 168) GN=glnA PE=1 SV=3 120 515 2.0E-39
sp|A0R083|GLNA2_MYCS2 Probable glutamine synthetase 2 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=glnA PE=1 SV=1 50 515 4.0E-39
sp|P9WN37|GLNA2_MYCTU Probable glutamine synthetase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=glnA2 PE=1 SV=1 50 515 1.0E-38
sp|Q60182|GLNA_METJA Glutamine synthetase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=glnA PE=3 SV=1 120 515 1.0E-38
sp|Q9HNI2|GLNA_HALSA Glutamine synthetase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=glnA PE=3 SV=1 120 516 1.0E-38
sp|P64246|GLNA2_MYCBO Probable glutamine synthetase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=glnA2 PE=3 SV=1 50 515 1.0E-38
sp|P9WN36|GLNA2_MYCTO Probable glutamine synthetase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=glnA2 PE=3 SV=1 50 515 1.0E-38
sp|Q9CDL9|GLNA_LACLA Glutamine synthetase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=glnA PE=3 SV=1 120 516 4.0E-38
sp|P45627|GLNA_LACDE Glutamine synthetase OS=Lactobacillus delbrueckii subsp. bulgaricus GN=glnA PE=3 SV=1 120 515 1.0E-36
sp|A9ZPH9|GMAS_METMY Glutamate--methylamine ligase OS=Methylovorus mays PE=1 SV=1 65 516 5.0E-36
sp|Q5HPN2|GLNA_STAEQ Glutamine synthetase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=glnA PE=3 SV=1 120 516 1.0E-35
sp|P21154|GLNA_METVO Glutamine synthetase OS=Methanococcus voltae GN=glnA PE=3 SV=1 120 515 1.0E-35
sp|Q8CSR8|GLNA_STAES Glutamine synthetase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=glnA PE=3 SV=1 120 516 1.0E-35
sp|P99095|GLNA_STAAN Glutamine synthetase OS=Staphylococcus aureus (strain N315) GN=glnA PE=1 SV=1 120 516 8.0E-35
sp|P60890|GLNA_STAAM Glutamine synthetase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=glnA PE=3 SV=1 120 516 8.0E-35
sp|Q6GHC6|GLNA_STAAR Glutamine synthetase OS=Staphylococcus aureus (strain MRSA252) GN=glnA PE=3 SV=1 120 516 9.0E-35
sp|P0A039|GLNA_STAAW Glutamine synthetase OS=Staphylococcus aureus (strain MW2) GN=glnA PE=3 SV=1 120 516 9.0E-35
sp|P0A040|GLNA_STAAU Glutamine synthetase OS=Staphylococcus aureus GN=glnA PE=3 SV=1 120 516 9.0E-35
sp|Q6G9Q4|GLNA_STAAS Glutamine synthetase OS=Staphylococcus aureus (strain MSSA476) GN=glnA PE=3 SV=1 120 516 9.0E-35
sp|Q5HGC3|GLNA_STAAC Glutamine synthetase OS=Staphylococcus aureus (strain COL) GN=glnA PE=3 SV=1 120 516 9.0E-35
sp|Q9HH09|GLNA_SULAC Glutamine synthetase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=glnA PE=1 SV=2 120 517 1.0E-34
sp|P78061|PUUA_ECOLI Gamma-glutamylputrescine synthetase PuuA OS=Escherichia coli (strain K12) GN=puuA PE=1 SV=2 60 512 1.0E-34
sp|O27612|GLNA_METTH Glutamine synthetase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=glnA PE=3 SV=1 120 517 2.0E-34
sp|F5RH07|GMAS_METUF Glutamate--methylamine ligase OS=Methyloversatilis universalis (strain ATCC BAA-1314 / JCM 13912 / FAM5) GN=gms PE=1 SV=1 48 516 1.0E-33
sp|P05457|GLNA1_BRADU Glutamine synthetase 1 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=glnA PE=3 SV=2 120 503 3.0E-33
sp|O59648|GLNA_METMP Glutamine synthetase OS=Methanococcus maripaludis (strain S2 / LL) GN=glnA PE=3 SV=1 120 516 3.0E-33
sp|O87393|GLNA3_RHIME Glutamine synthetase 3 OS=Rhizobium meliloti (strain 1021) GN=glnT PE=1 SV=1 62 517 7.0E-33
sp|Q86B00|GLNA1_DICDI Type-1 glutamine synthetase 1 OS=Dictyostelium discoideum GN=glnA1 PE=3 SV=1 146 516 9.0E-33
sp|O29313|GLNA_ARCFU Glutamine synthetase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=glnA PE=3 SV=1 120 517 1.0E-32
sp|P31592|GLNA3_RHILP Glutamine synthetase 3 OS=Rhizobium leguminosarum bv. phaseoli GN=glnT PE=1 SV=1 52 510 1.0E-32
sp|P00964|GLNA_NOSS1 Glutamine synthetase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=glnA PE=1 SV=3 127 445 4.0E-32
sp|Q59747|GLNA1_RHIME Glutamine synthetase 1 OS=Rhizobium meliloti (strain 1021) GN=glnA PE=3 SV=2 120 503 5.0E-32
sp|Q9KNJ2|GLNA_VIBCH Glutamine synthetase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=glnA PE=3 SV=1 120 514 8.0E-31
sp|P23794|GLNA_SULSO Glutamine synthetase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=glnA PE=3 SV=2 48 517 1.0E-30
sp|P94126|GLNA_AZOC5 Glutamine synthetase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=glnA PE=3 SV=2 120 514 2.0E-30
sp|P94845|GLNA_HELPY Glutamine synthetase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=glnA PE=3 SV=2 118 512 4.0E-30
sp|P9WN38|GLNA1_MYCTO Glutamine synthetase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=glnA1 PE=3 SV=1 120 443 5.0E-30
sp|P0A591|GLNA1_MYCBO Glutamine synthetase 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=glnA1 PE=3 SV=1 120 443 5.0E-30
sp|P9WN39|GLNA1_MYCTU Glutamine synthetase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=glnA1 PE=1 SV=1 120 443 5.0E-30
sp|P33035|GLNA_MICDP Glutamine synthetase OS=Microchaete diplosiphon GN=glnA PE=3 SV=2 143 445 6.0E-30
sp|A0R079|GLNA1_MYCS2 Glutamine synthetase 1 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=glnA PE=1 SV=1 120 445 9.0E-30
sp|P19904|GLNA_VIBAL Glutamine synthetase OS=Vibrio alginolyticus GN=glnA PE=3 SV=1 120 500 1.0E-29
sp|Q3V5W6|GLNA_PSETA Glutamine synthetase OS=Pseudomonas taetrolens GN=glnA PE=1 SV=1 120 502 1.0E-29
sp|Q9HU65|GLNA_PSEAE Glutamine synthetase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=glnA PE=1 SV=1 120 502 1.0E-29
sp|P22248|GLNA_AZOVI Glutamine synthetase OS=Azotobacter vinelandii GN=glnA PE=3 SV=1 120 502 2.0E-29
sp|P10583|GLNA_AZOBR Glutamine synthetase OS=Azospirillum brasilense GN=glnA PE=3 SV=1 142 514 7.0E-29
sp|Q9CLP2|GLNA_PASMU Glutamine synthetase OS=Pasteurella multocida (strain Pm70) GN=glnA PE=3 SV=1 120 500 1.0E-28
sp|P15106|GLNA_STRCO Glutamine synthetase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=glnA PE=2 SV=1 120 445 1.0E-28
sp|P25821|GLNA_NEIGO Glutamine synthetase OS=Neisseria gonorrhoeae GN=glnA PE=3 SV=1 120 514 2.0E-28
sp|P0A9C8|GLNA_SHIFL Glutamine synthetase OS=Shigella flexneri GN=glnA PE=3 SV=2 120 498 5.0E-28
sp|P0A9C5|GLNA_ECOLI Glutamine synthetase OS=Escherichia coli (strain K12) GN=glnA PE=1 SV=2 120 498 5.0E-28
sp|P0A9C6|GLNA_ECOL6 Glutamine synthetase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=glnA PE=3 SV=2 120 498 5.0E-28
sp|P0A9C7|GLNA_ECO57 Glutamine synthetase OS=Escherichia coli O157:H7 GN=glnA PE=3 SV=2 120 498 5.0E-28
sp|P43794|GLNA_HAEIN Glutamine synthetase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=glnA PE=3 SV=1 120 514 6.0E-28
sp|Q9ZLW5|GLNA_HELPJ Glutamine synthetase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=glnA PE=3 SV=1 118 512 1.0E-27
sp|P77958|GLNA1_STRFL Glutamine synthetase 1 OS=Streptomyces filamentosus GN=glnA PE=3 SV=1 120 445 2.0E-27
sp|P0A1P7|GLNA_SALTI Glutamine synthetase OS=Salmonella typhi GN=glnA PE=3 SV=2 120 498 4.0E-27
sp|P0A1P6|GLNA_SALTY Glutamine synthetase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=glnA PE=1 SV=2 120 498 4.0E-27
sp|P28786|GLNA_PROHU Glutamine synthetase OS=Proteus hauseri GN=glnA PE=3 SV=1 120 438 6.0E-27
sp|Q05542|GLNA1_STRVR Glutamine synthetase 1 OS=Streptomyces viridochromogenes GN=glnI PE=3 SV=1 120 445 1.0E-26
sp|P15124|GLNA_METCA Glutamine synthetase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=glnA PE=3 SV=2 120 499 2.0E-26
sp|P13499|GLNA_RHOCA Glutamine synthetase (Fragment) OS=Rhodobacter capsulatus GN=glnA PE=3 SV=2 86 438 4.0E-26
sp|P77961|GLNA_SYNY3 Glutamine synthetase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=glnA PE=1 SV=2 120 501 2.0E-25
sp|Q46ZL2|3HAPM_CUPPJ 3-hydroxylaminophenol mutase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=Reut_A2057 PE=1 SV=1 120 438 2.0E-25
sp|P43518|GLNA_RHOSH Glutamine synthetase OS=Rhodobacter sphaeroides GN=glnA PE=3 SV=1 57 438 2.0E-25
sp|P09826|GLNA1_RHILV Glutamine synthetase 1 OS=Rhizobium leguminosarum bv. viciae GN=glnA PE=3 SV=1 120 503 6.0E-25
sp|P07804|GLNA_ACIFR Glutamine synthetase OS=Acidithiobacillus ferrooxidans GN=glnA PE=3 SV=1 120 514 4.0E-24
sp|P28605|GLNA_SYNP2 Glutamine synthetase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=glnA PE=3 SV=2 120 438 6.0E-24
sp|O66514|GLNA_AQUAE Glutamine synthetase OS=Aquifex aeolicus (strain VF5) GN=glnA PE=3 SV=1 120 438 2.0E-23
sp|P46033|GLNA1_FRAAL Glutamine synthetase 1 OS=Frankia alni GN=glnA PE=3 SV=1 120 443 3.0E-23
sp|Q0GA40|LGSN_RABIT Lengsin OS=Oryctolagus cuniculus GN=LGSN PE=2 SV=1 60 516 6.0E-21
sp|Q1ZZS1|LGSN_CANLF Lengsin OS=Canis lupus familiaris GN=LGSN PE=2 SV=1 60 516 2.0E-20
sp|Q5TDP6|LGSN_HUMAN Lengsin OS=Homo sapiens GN=LGSN PE=1 SV=1 60 516 2.0E-17
sp|Q8CIX8|LGSN_MOUSE Lengsin OS=Mus musculus GN=Lgsn PE=1 SV=1 60 516 3.0E-17
sp|Q7TT51|LGSN_RAT Lengsin OS=Rattus norvegicus GN=Lgsn PE=2 SV=1 60 491 5.0E-17
sp|P38094|FLUG_EMENI Protein fluG OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fluG PE=1 SV=1 73 514 2.0E-14
sp|P51120|GLNA_TRITH Glutamine synthetase (Fragment) OS=Trichodesmium thiebautii GN=glnA PE=3 SV=1 247 372 3.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0004356 glutamate-ammonia ligase activity Yes
GO:0006807 nitrogen compound metabolic process Yes
GO:0008152 metabolic process No
GO:0016874 ligase activity No
GO:0008150 biological_process No
GO:0016211 ammonia ligase activity No
GO:0003674 molecular_function No
GO:0016880 acid-ammonia (or amide) ligase activity No
GO:0016879 ligase activity, forming carbon-nitrogen bonds No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1000
MAPSTSSSSAAAAPTPGANGTDGDGSNSGGSSDGQRRMARPAGKITVDALPALLERDTRVKLAGVDIDGILRGKI
VSKNKFLSVAQAGFGFCSVIFGWDMHDQTYARELAVSNAANGYRDMLAIPDLDSFRRIPWEADMPFFLVSFFDPE
SGSPICACPRGLLKTQLDRLRASGYGAMAGAEYEFYTFRTPDSSSDSSPARFLQQNPPQQLPSLTEGMFGYSLTR
PVHNKNWYLDVYDTCTSFGCDIEGWHTESGPGVFEAALEFHPMAEMADRASLFKLAVKGVGAVHGVTPCFMAKPK
QGLPGNSGHMHVSVVDGDGKNLLARDSLDEAAPWKDAAGLSDLGRHFLAGLLVGLPDIMPILAPTVNSYKRLVEN
FWAPVTVSWGLEHRAASIRVIAPPTSKPSATRLEVRVPGADTNPHLVLAAILGCGWRGVERRLAIPCPPLAMGQD
VGGAADQGERLAKSLKEATARFVRADSVAREVFGDAFVDHFAGTRENEVRLFEEAVTDWEMKRYIETV*
Coding >Hirsu2|1000
ATGGCTCCCTCCACCTCGTCCTCCTCCGCCGCCGCTGCCCCGACGCCCGGCGCCAATGGCACCGACGGCGACGGG
AGCAATAGCGGCGGCAGCAGCGATGGTCAGAGGAGGATGGCGCGGCCGGCGGGCAAGATAACCGTTGACGCCCTG
CCCGCGCTCCTCGAGCGAGACACGCGCGTCAAGCTGGCGGGCGTCGACATCGACGGCATCCTCCGCGGCAAGATC
GTGTCCAAGAACAAGTTCCTGTCCGTCGCCCAGGCCGGCTTCGGCTTCTGTTCCGTCATATTCGGCTGGGACATG
CACGACCAGACGTACGCGCGCGAGCTGGCCGTCTCCAACGCGGCCAACGGCTACCGCGACATGCTCGCCATCCCC
GACCTCGACTCCTTCCGCCGCATCCCCTGGGAGGCCGACATGCCCTTCTTCCTCGTCAGCTTCTTCGACCCGGAG
TCGGGCAGCCCCATCTGCGCCTGTCCGCGCGGCCTTCTCAAGACGCAGCTCGACCGCCTGCGCGCCAGCGGTTAC
GGCGCCATGGCCGGAGCCGAGTACGAATTCTACACCTTCCGCACCCCCGACTCTTCGTCCGACTCGTCGCCCGCG
CGCTTCCTGCAGCAGAACCCGCCGCAGCAGCTGCCGTCGCTGACGGAGGGCATGTTCGGCTACTCGCTGACGCGC
CCCGTCCACAACAAGAACTGGTACCTGGATGTGTACGACACGTGCACCAGCTTCGGCTGCGACATCGAGGGCTGG
CACACCGAGTCGGGCCCGGGCGTCTTCGAGGCCGCGCTCGAGTTCCACCCGATGGCCGAGATGGCGGACCGGGCC
AGCCTGTTCAAGTTGGCCGTCAAGGGCGTCGGCGCCGTCCACGGCGTCACGCCCTGCTTCATGGCCAAGCCCAAG
CAGGGCCTGCCCGGCAACAGCGGGCACATGCACGTGTCCGTCGTCGACGGCGACGGCAAGAACCTGCTGGCCAGG
GACTCGCTGGACGAGGCGGCGCCGTGGAAGGACGCGGCCGGCCTGTCCGACCTGGGCCGGCACTTCCTGGCCGGT
CTGCTGGTCGGGCTGCCGGACATCATGCCGATCCTGGCGCCGACGGTCAACTCGTACAAGCGCCTGGTCGAGAAC
TTCTGGGCGCCCGTGACGGTCTCGTGGGGGCTCGAGCACCGGGCCGCGTCGATCCGGGTGATTGCGCCGCCGACG
TCGAAGCCGTCGGCGACGCGGCTCGAGGTGCGCGTCCCCGGCGCTGACACCAACCCGCACCTGGTCCTGGCCGCC
ATCCTCGGCTGCGGCTGGCGCGGCGTCGAGCGCCGGCTGGCCATCCCGTGCCCGCCGTTGGCCATGGGCCAGGAC
GTCGGCGGCGCCGCCGACCAGGGCGAGCGCCTGGCCAAGAGCCTCAAGGAGGCGACGGCGCGCTTCGTGCGGGCC
GACAGCGTCGCGCGCGAGGTCTTTGGCGACGCCTTCGTCGACCACTTTGCCGGCACGCGCGAGAACGAAGTGAGG
CTGTTTGAGGAGGCCGTCACCGATTGGGAGATGAAGCGCTATATTGAAACCGTTTGA
Transcript >Hirsu2|1000
ATGGCTCCCTCCACCTCGTCCTCCTCCGCCGCCGCTGCCCCGACGCCCGGCGCCAATGGCACCGACGGCGACGGG
AGCAATAGCGGCGGCAGCAGCGATGGTCAGAGGAGGATGGCGCGGCCGGCGGGCAAGATAACCGTTGACGCCCTG
CCCGCGCTCCTCGAGCGAGACACGCGCGTCAAGCTGGCGGGCGTCGACATCGACGGCATCCTCCGCGGCAAGATC
GTGTCCAAGAACAAGTTCCTGTCCGTCGCCCAGGCCGGCTTCGGCTTCTGTTCCGTCATATTCGGCTGGGACATG
CACGACCAGACGTACGCGCGCGAGCTGGCCGTCTCCAACGCGGCCAACGGCTACCGCGACATGCTCGCCATCCCC
GACCTCGACTCCTTCCGCCGCATCCCCTGGGAGGCCGACATGCCCTTCTTCCTCGTCAGCTTCTTCGACCCGGAG
TCGGGCAGCCCCATCTGCGCCTGTCCGCGCGGCCTTCTCAAGACGCAGCTCGACCGCCTGCGCGCCAGCGGTTAC
GGCGCCATGGCCGGAGCCGAGTACGAATTCTACACCTTCCGCACCCCCGACTCTTCGTCCGACTCGTCGCCCGCG
CGCTTCCTGCAGCAGAACCCGCCGCAGCAGCTGCCGTCGCTGACGGAGGGCATGTTCGGCTACTCGCTGACGCGC
CCCGTCCACAACAAGAACTGGTACCTGGATGTGTACGACACGTGCACCAGCTTCGGCTGCGACATCGAGGGCTGG
CACACCGAGTCGGGCCCGGGCGTCTTCGAGGCCGCGCTCGAGTTCCACCCGATGGCCGAGATGGCGGACCGGGCC
AGCCTGTTCAAGTTGGCCGTCAAGGGCGTCGGCGCCGTCCACGGCGTCACGCCCTGCTTCATGGCCAAGCCCAAG
CAGGGCCTGCCCGGCAACAGCGGGCACATGCACGTGTCCGTCGTCGACGGCGACGGCAAGAACCTGCTGGCCAGG
GACTCGCTGGACGAGGCGGCGCCGTGGAAGGACGCGGCCGGCCTGTCCGACCTGGGCCGGCACTTCCTGGCCGGT
CTGCTGGTCGGGCTGCCGGACATCATGCCGATCCTGGCGCCGACGGTCAACTCGTACAAGCGCCTGGTCGAGAAC
TTCTGGGCGCCCGTGACGGTCTCGTGGGGGCTCGAGCACCGGGCCGCGTCGATCCGGGTGATTGCGCCGCCGACG
TCGAAGCCGTCGGCGACGCGGCTCGAGGTGCGCGTCCCCGGCGCTGACACCAACCCGCACCTGGTCCTGGCCGCC
ATCCTCGGCTGCGGCTGGCGCGGCGTCGAGCGCCGGCTGGCCATCCCGTGCCCGCCGTTGGCCATGGGCCAGGAC
GTCGGCGGCGCCGCCGACCAGGGCGAGCGCCTGGCCAAGAGCCTCAAGGAGGCGACGGCGCGCTTCGTGCGGGCC
GACAGCGTCGCGCGCGAGGTCTTTGGCGACGCCTTCGTCGACCACTTTGCCGGCACGCGCGAGAACGAAGTGAGG
CTGTTTGAGGAGGCCGTCACCGATTGGGAGATGAAGCGCTATATTGAAACCGTTTGA
Gene >Hirsu2|1000
ATGGCTCCCTCCACCTCGTCCTCCTCCGCCGCCGCTGCCCCGACGCCCGGCGCCAATGGCACCGACGGCGACGGG
AGCAATAGCGGCGGCAGCAGCGATGGTCAGAGGAGGATGGCGCGGCCGGCGGGCAAGATAACCGTTGACGCCCTG
CCCGCGCTCCTCGAGCGAGACACGCGCGTCAAGCTGGCGGGCGTCGACATCGACGGCATCCTCCGCGGCAAGATC
GTGTCCAAGAACAAGTTCCTGTCCGTCGCCCAGGCCGGCTTCGGCTTCTGTTCCGTCATATTCGGCTGGGACATG
CACGACCAGACGTACGCGCGCGAGCTGGCCGTCTCCAACGCGGCCAACGGCTACCGCGACATGCTCGCCATCCCC
GACCTCGACTCCTTCCGCCGCATCCCCTGGGAGGCCGACATGCCCTTCTTCCTCGTCAGCTTCTTCGACCCGGAG
TCGGGCAGCCCCATCTGCGCCTGTCCGCGCGGCCTTCTCAAGACGCAGCTCGACCGCCTGCGCGCCAGCGGTTAC
GGCGCCATGGCCGGAGGTCAGACTTGCCCCTGCTCCCGTTACCGCTTCTCCTCCTCCTCCGCCTCGTGCTGACCG
GCCGTCTTGTCCGTCTTGCTGTTCCTCCGTTCAGCCGAGTACGAATTCTACACCTTCCGCACCCCCGACTCTTCG
TCCGACTCGTCGCCCGCGCGCTTCCTGCAGCAGAACCCGCCGCAGCAGCTGCCGTCGCTGACGGAGGGCATGTTC
GGCTACTCGCTGACGCGCCCCGTCCACAACAAGAACTGGTACCTGGATGTGTACGACACGTGCACCAGCTTCGGC
TGCGACATCGAGGGCTGGCACACCGAGTCGGGCCCGGGCGTCTTCGAGGCCGCGCTCGAGTTCCACCCGATGGCC
GAGATGGCGGACCGGGCCAGCCTGTTCAAGTTGGCCGTCAAGGGCGTCGGCGCCGTCCACGGCGTCACGCCCTGC
TTCATGGCCAAGCCCAAGCAGGGCCTGCCCGGCAACAGCGGGCACATGCACGTGTCCGTCGTCGACGGCGACGGC
AAGAACCTGCTGGCCAGGGACTCGCTGGACGAGGCGGCGCCGTGGAAGGACGCGGCCGGCCTGTCCGACCTGGGC
CGGCACTTCCTGGCCGGTCTGCTGGTCGGGCTGCCGGACATCATGCCGATCCTGGCGCCGACGGTCAACTCGTAC
AAGCGCCTGGTCGAGAACTTCTGGGCGCCCGTGACGGTCTCGTGGGGGCTCGAGCACCGGGCCGCGTCGATCCGG
GTGATTGCGCCGCCGACGTCGAAGCCGTCGGCGACGCGGCTCGAGGTGCGCGTCCCCGGCGCTGACACCAACCCG
CACCTGGTCCTGGCCGCCATCCTCGGCTGCGGCTGGCGCGGCGTCGAGCGCCGGCTGGCCATCCCGTGCCCGCCG
TTGGCCATGGGCCAGGACGTCGGCGGCGCCGCCGACCAGGGCGAGCGCCTGGCCAAGAGCCTCAAGGAGGCGACG
GCGCGCTTCGTGCGGGCCGACAGCGTCGCGCGCGAGGTCTTTGGCGACGCCTTCGTCGACCACTTTGCCGGCACG
CGCGAGAACGAAGTGAGGCTGTTTGAGGAGGCCGTCACCGATTGGTGCGTATTCTCACTCCGTCTCCCCCCTTTC
TCTCTCTCTCTCTCTTTTTCTCTCCCTCTGTTCTCATCTTCCGTCTCTCACTCGTTCGCTCGCCCTTTGCCACAC
CTTCACACACACACACACTCACACTCACACTCTCTCTCCTCTCATCACTTCTCCTTCGCTTGTTCCTTCCCGATC
GTTTCTTCAACCAGCTGGCTCGTGGGCTGACTCGTGGCGTGCAGGGAGATGAAGCGCTATATTGAAACCGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail