Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS95_1|g9536.t1
Gene name
Locationscaffold_095:103154..105276
Strand+
Gene length (bp)2122
Transcript length (bp)2046
Coding sequence length (bp)2046
Protein length (aa) 682

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01915 Glyco_hydro_3_C Glycosyl hydrolase family 3 C-terminal domain 8.4E-51 137 542
PF14310 Fn3-like Fibronectin type III-like domain 6.8E-13 597 658
PF00933 Glyco_hydro_3 Glycosyl hydrolase family 3 N terminal domain 4.1E-12 5 102
PF07691 PA14 PA14 domain 2.4E-11 230 355

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0008150 biological_process No
GO:0003824 catalytic activity No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0016787 hydrolase activity No
GO:0044238 primary metabolic process No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID3
Orthogroup66
Change Orthofinder run
Species Protein ID
Aspergillus niger CBS 124.48 Ani_SJS7_1|g11109.t1
Aspergillus niger CBS 131.52 Ani_SJS8_1|g4980.t1
Aspergillus niger CBS 131.52 Ani_SJS8_1|g9167.t1
Aspergillus niger CBS 133816 Ani_SJS71_1|g10865.t1
Aspergillus niger CBS 147320 Ani_SJS28_1|g5050.t1
Aspergillus niger CBS 147321 Ani_SJS30_1|g6306.t1
Aspergillus niger CBS 147322 Ani_SJS35_1|g3639.t1
Aspergillus niger CBS 147322 Ani_SJS35_1|g7320.t1
Aspergillus niger CBS 147323 Ani_SJS38_1|g1486.t1
Aspergillus niger CBS 147323 Ani_SJS38_1|g1880.t1
Aspergillus niger CBS 147324 Ani_SJS39_1|g809.t1
Aspergillus niger CBS 147344 Ani_SJS70_1|g6133.t1
Aspergillus niger CBS 147344 Ani_SJS70_1|g10507.t1
Aspergillus niger CBS 147345 Ani_SJS72_1|g3900.t1
Aspergillus niger CBS 147345 Ani_SJS72_1|g1672.t1
Aspergillus niger CBS 147347 Ani_SJS76_1|g6247.t1
Aspergillus niger CBS 147347 Ani_SJS76_1|g3072.t1
Aspergillus niger CBS 147352 Ani_SJS95_1|g835.t1
Aspergillus niger CBS 147352 Ani_SJS95_1|g9536.t1 (this protein)
Aspergillus niger CBS 147352 Ani_SJS95_1|g9535.t1
Aspergillus niger CBS 147353 Ani_SJS100_1|g9300.t1
Aspergillus niger CBS 147353 Ani_SJS100_1|g5358.t1
Aspergillus niger CBS 147371 Ani_SJS27_1|g3651.t1
Aspergillus niger CBS 147482 Ani_SJS55_1|g3764.t1
Aspergillus niger CBS 147482 Ani_SJS55_1|g10814.t1
Aspergillus niger CBS 630.78 Ani_SJS18_1|g9368.t1
Aspergillus niger CBS 630.78 Ani_SJS18_1|g1298.t1
Aspergillus niger CBS 769.97 Ani_SJS82_1|g5691.t1
Aspergillus niger CBS 769.97 Ani_SJS82_1|g9954.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS95_1|g9536.t1
MVVRDANPWCLMTAYNRVNGAHCDENVELLTDILRKEWGWEGVAMSDWGGAHDAAQSLVAGLDLEMPGPPVRRTW
EIVQQYLADSKITEADVDRSVHRILRLLKRTKRFENDSEHPETTLRNSNNTARLLHAAQSGIVLLKNEAGCLPLW
PSEGLERVGIFGPNSARVVAGGGGSSYIKAPYWTNVDDSLTARFQDTTTEIVRNVGAKVNRYLPAITLAATRNPD
TGGQGAAIDWFSGHDLSGQPTETIHTDDLYYINFGNTPQTIATETGFSFRLRTTIVPLTTGTHRLSLASIGPSKL
YISGQLMAHQDGNFEKRGTLFFIYGSHEAIFTLDMVAGQEYHVEIEYWSHDRQLSAELLPRMDPMEDKFQGVRLG
YEEANRRDLPSEAAKQARDCEAAVVVVGRDREWETEGQDVLMFALPGEQVRLIEEVAAVCARTIVVIQSGTPVQL
EPWIENVKGVVCAWYQGQELGNATASVVCGEFNLSGRLPMTWPRRLEECPAFSSFRVEAHEIQYAEGIYVGGRWW
DLLGTQPMYPLGYGLSYNTFALRIVHPEQLAMVTGPQPVQVIVEVTHRGDGAVGLPGRETVIAWCEVVDSGNGRL
ARPPKQVSAFAKSPLLAPGETCTVSLSITAYELGVYDPERQKWVLDKGAQFRILVGADAAHTQKAGTIHVPETIT
WVHRLD*
Coding >Ani_SJS95_1|g9536.t1
ATGGTGGTGCGGGACGCCAACCCCTGGTGCTTGATGACTGCGTACAACCGCGTCAACGGCGCCCACTGCGACGAA
AATGTCGAGCTGCTGACCGACATCCTGCGTAAGGAATGGGGCTGGGAAGGCGTAGCTATGAGTGACTGGGGCGGC
GCCCACGACGCTGCCCAGTCCCTGGTCGCCGGGCTGGACCTGGAGATGCCCGGCCCGCCAGTGCGGCGCACCTGG
GAGATAGTCCAGCAGTATCTCGCGGACAGCAAGATCACCGAGGCCGACGTTGACCGCTCCGTGCATCGCATCTTG
CGCCTCCTGAAACGGACCAAGCGGTTCGAGAACGACTCCGAGCATCCAGAGACCACGCTCAGAAACTCCAACAAC
ACGGCCCGACTGTTGCACGCCGCGCAGTCGGGTATTGTATTACTGAAAAATGAGGCCGGCTGCCTGCCCCTGTGG
CCATCGGAGGGACTGGAACGCGTGGGCATTTTCGGCCCTAACTCTGCGCGCGTCGTCGCCGGTGGTGGGGGTAGC
TCTTACATCAAGGCGCCGTACTGGACCAACGTGGACGACTCTCTTACGGCCCGCTTTCAGGACACTACCACGGAG
ATTGTGCGGAATGTCGGTGCGAAGGTAAATCGGTACCTGCCCGCGATAACTTTGGCGGCAACCCGTAACCCTGAT
ACGGGCGGCCAGGGCGCTGCGATCGACTGGTTTAGCGGCCATGATCTGTCTGGGCAGCCCACGGAGACCATCCAC
ACCGACGATCTGTATTACATCAATTTCGGCAATACGCCTCAGACTATTGCCACAGAAACTGGCTTTAGCTTTCGA
CTGCGCACGACCATCGTGCCACTTACTACTGGTACGCACCGCCTCTCCCTCGCTAGCATCGGCCCCTCCAAGCTC
TACATCTCCGGCCAGCTCATGGCCCATCAAGACGGCAATTTCGAGAAGCGGGGCACGCTATTCTTCATCTACGGC
TCCCATGAAGCCATCTTCACGCTTGACATGGTCGCAGGCCAGGAATATCACGTGGAGATAGAGTATTGGTCGCAT
GACCGGCAGCTCTCAGCCGAGCTTCTTCCGCGCATGGACCCCATGGAAGACAAATTTCAGGGCGTCCGCCTCGGC
TACGAGGAAGCCAACCGAAGAGACCTGCCTAGCGAGGCGGCAAAGCAAGCCAGAGACTGCGAGGCAGCCGTTGTT
GTCGTCGGTCGCGACCGCGAGTGGGAGACCGAGGGCCAGGACGTGCTGATGTTCGCGCTGCCGGGCGAGCAGGTC
CGGTTAATCGAGGAGGTGGCGGCAGTGTGCGCGCGCACGATCGTCGTCATCCAGAGCGGCACACCCGTGCAGCTT
GAGCCGTGGATCGAGAACGTCAAGGGAGTGGTCTGTGCTTGGTATCAGGGCCAGGAGCTGGGAAACGCGACGGCC
AGCGTCGTCTGCGGTGAATTTAATCTCTCGGGTCGTTTACCGATGACATGGCCTAGGCGACTGGAGGAGTGTCCA
GCGTTCTCGTCCTTCCGGGTTGAGGCGCATGAAATTCAGTATGCCGAGGGAATATATGTGGGGGGGCGTTGGTGG
GATTTGTTGGGGACGCAGCCCATGTACCCGCTGGGGTATGGGCTGTCGTACAATACGTTTGCCCTGCGGATTGTT
CATCCTGAACAGCTGGCGATGGTGACTGGGCCGCAGCCGGTGCAGGTAATAGTTGAGGTGACACACCGCGGAGAT
GGAGCGGTGGGTCTGCCAGGCCGAGAGACGGTCATCGCGTGGTGTGAGGTTGTCGACTCCGGGAACGGACGTTTG
GCCCGCCCTCCGAAGCAGGTCAGCGCATTTGCAAAGTCGCCACTCCTCGCACCCGGTGAGACGTGCACCGTGAGC
CTGTCAATCACCGCGTATGAGCTGGGGGTCTATGACCCGGAGCGCCAGAAATGGGTTCTCGACAAGGGGGCGCAG
TTTCGCATCTTGGTGGGCGCGGATGCGGCGCACACGCAGAAGGCAGGCACCATTCACGTACCGGAGACCATTACC
TGGGTTCATCGCCTTGATTAG
Transcript >Ani_SJS95_1|g9536.t1
ATGGTGGTGCGGGACGCCAACCCCTGGTGCTTGATGACTGCGTACAACCGCGTCAACGGCGCCCACTGCGACGAA
AATGTCGAGCTGCTGACCGACATCCTGCGTAAGGAATGGGGCTGGGAAGGCGTAGCTATGAGTGACTGGGGCGGC
GCCCACGACGCTGCCCAGTCCCTGGTCGCCGGGCTGGACCTGGAGATGCCCGGCCCGCCAGTGCGGCGCACCTGG
GAGATAGTCCAGCAGTATCTCGCGGACAGCAAGATCACCGAGGCCGACGTTGACCGCTCCGTGCATCGCATCTTG
CGCCTCCTGAAACGGACCAAGCGGTTCGAGAACGACTCCGAGCATCCAGAGACCACGCTCAGAAACTCCAACAAC
ACGGCCCGACTGTTGCACGCCGCGCAGTCGGGTATTGTATTACTGAAAAATGAGGCCGGCTGCCTGCCCCTGTGG
CCATCGGAGGGACTGGAACGCGTGGGCATTTTCGGCCCTAACTCTGCGCGCGTCGTCGCCGGTGGTGGGGGTAGC
TCTTACATCAAGGCGCCGTACTGGACCAACGTGGACGACTCTCTTACGGCCCGCTTTCAGGACACTACCACGGAG
ATTGTGCGGAATGTCGGTGCGAAGGTAAATCGGTACCTGCCCGCGATAACTTTGGCGGCAACCCGTAACCCTGAT
ACGGGCGGCCAGGGCGCTGCGATCGACTGGTTTAGCGGCCATGATCTGTCTGGGCAGCCCACGGAGACCATCCAC
ACCGACGATCTGTATTACATCAATTTCGGCAATACGCCTCAGACTATTGCCACAGAAACTGGCTTTAGCTTTCGA
CTGCGCACGACCATCGTGCCACTTACTACTGGTACGCACCGCCTCTCCCTCGCTAGCATCGGCCCCTCCAAGCTC
TACATCTCCGGCCAGCTCATGGCCCATCAAGACGGCAATTTCGAGAAGCGGGGCACGCTATTCTTCATCTACGGC
TCCCATGAAGCCATCTTCACGCTTGACATGGTCGCAGGCCAGGAATATCACGTGGAGATAGAGTATTGGTCGCAT
GACCGGCAGCTCTCAGCCGAGCTTCTTCCGCGCATGGACCCCATGGAAGACAAATTTCAGGGCGTCCGCCTCGGC
TACGAGGAAGCCAACCGAAGAGACCTGCCTAGCGAGGCGGCAAAGCAAGCCAGAGACTGCGAGGCAGCCGTTGTT
GTCGTCGGTCGCGACCGCGAGTGGGAGACCGAGGGCCAGGACGTGCTGATGTTCGCGCTGCCGGGCGAGCAGGTC
CGGTTAATCGAGGAGGTGGCGGCAGTGTGCGCGCGCACGATCGTCGTCATCCAGAGCGGCACACCCGTGCAGCTT
GAGCCGTGGATCGAGAACGTCAAGGGAGTGGTCTGTGCTTGGTATCAGGGCCAGGAGCTGGGAAACGCGACGGCC
AGCGTCGTCTGCGGTGAATTTAATCTCTCGGGTCGTTTACCGATGACATGGCCTAGGCGACTGGAGGAGTGTCCA
GCGTTCTCGTCCTTCCGGGTTGAGGCGCATGAAATTCAGTATGCCGAGGGAATATATGTGGGGGGGCGTTGGTGG
GATTTGTTGGGGACGCAGCCCATGTACCCGCTGGGGTATGGGCTGTCGTACAATACGTTTGCCCTGCGGATTGTT
CATCCTGAACAGCTGGCGATGGTGACTGGGCCGCAGCCGGTGCAGGTAATAGTTGAGGTGACACACCGCGGAGAT
GGAGCGGTGGGTCTGCCAGGCCGAGAGACGGTCATCGCGTGGTGTGAGGTTGTCGACTCCGGGAACGGACGTTTG
GCCCGCCCTCCGAAGCAGGTCAGCGCATTTGCAAAGTCGCCACTCCTCGCACCCGGTGAGACGTGCACCGTGAGC
CTGTCAATCACCGCGTATGAGCTGGGGGTCTATGACCCGGAGCGCCAGAAATGGGTTCTCGACAAGGGGGCGCAG
TTTCGCATCTTGGTGGGCGCGGATGCGGCGCACACGCAGAAGGCAGGCACCATTCACGTACCGGAGACCATTACC
TGGGTTCATCGCCTTGATTAG
Gene >Ani_SJS95_1|g9536.t1
ATGGTGGTGCGGGACGCCAACCCCTGGTGCTTGATGACTGCGTACAACCGCGTCAACGGCGCCCACTGCGACGAA
AATGTCGAGCTGCTGACCGACATCCTGCGTAAGGAATGGGGCTGGGAAGGCGTAGCTATGAGTGACTGGGGCGGC
GCCCACGACGCTGCCCAGTCCCTGGTCGCCGGGCTGGACCTGGAGATGCCCGGCCCGCCAGTGCGGCGCACCTGG
GAGATAGTCCAGCAGTATCTCGCGGACAGCAAGATCACCGAGGCCGACGTTGACCGCTCCGTGCATCGCATCTTG
CGCCTCCTGAAACGGACCAAGCGGTTCGAGAACGACTCCGAGCATCCAGAGACCACGCTCAGAAACTCCAACAAC
ACGGCCCGACTGTTGCACGCCGCGCAGTCGGGTATTGTATTACTGAAAAATGAGGCCGGCTGCCTGCCCCTGTGG
CCATCGGAGGGACTGGAACGCGTGGGCATTTTCGGCCCTAACTCTGCGCGCGTCGTCGCCGGTGGTGGGGGTAGC
TCTTACATCAAGGCGCCGTACTGGACCAACGTGGACGACTCTCTTACGGCCCGCTTTCAGGACACTACCACGGAG
ATTGTGCGGAATGTCGGTGCGAAGGTAAATCGGTACCTGCCCGCGATAACTTTGGCGGCAACCCGTAACCCTGAT
ACGGGCGGCCAGGGCGCTGCGATCGACTGGTTTAGCGGCCATGATCTGTCTGGGCAGCCCACGGAGACCATCCAC
ACGTAAGTGGAATCCCCTCTTCTTATCATCCAGTCTATTCCGAAACATCTCCCTAATTTGATGTTCGATGGCCCA
TAGCGACGATCTGTATTACATCAATTTCGGCAATACGCCTCAGACTATTGCCACAGAAACTGGCTTTAGCTTTCG
ACTGCGCACGACCATCGTGCCACTTACTACTGGTACGCACCGCCTCTCCCTCGCTAGCATCGGCCCCTCCAAGCT
CTACATCTCCGGCCAGCTCATGGCCCATCAAGACGGCAATTTCGAGAAGCGGGGCACGCTATTCTTCATCTACGG
CTCCCATGAAGCCATCTTCACGCTTGACATGGTCGCAGGCCAGGAATATCACGTGGAGATAGAGTATTGGTCGCA
TGACCGGCAGCTCTCAGCCGAGCTTCTTCCGCGCATGGACCCCATGGAAGACAAATTTCAGGGCGTCCGCCTCGG
CTACGAGGAAGCCAACCGAAGAGACCTGCCTAGCGAGGCGGCAAAGCAAGCCAGAGACTGCGAGGCAGCCGTTGT
TGTCGTCGGTCGCGACCGCGAGTGGGAGACCGAGGGCCAGGACGTGCTGATGTTCGCGCTGCCGGGCGAGCAGGT
CCGGTTAATCGAGGAGGTGGCGGCAGTGTGCGCGCGCACGATCGTCGTCATCCAGAGCGGCACACCCGTGCAGCT
TGAGCCGTGGATCGAGAACGTCAAGGGAGTGGTCTGTGCTTGGTATCAGGGCCAGGAGCTGGGAAACGCGACGGC
CAGCGTCGTCTGCGGTGAATTTAATCTCTCGGGTCGTTTACCGATGACATGGCCTAGGCGACTGGAGGAGTGTCC
AGCGTTCTCGTCCTTCCGGGTTGAGGCGCATGAAATTCAGTATGCCGAGGGAATATATGTGGGGGGGCGTTGGTG
GGATTTGTTGGGGACGCAGCCCATGTACCCGCTGGGGTATGGGCTGTCGTACAATACGTTTGCCCTGCGGATTGT
TCATCCTGAACAGCTGGCGATGGTGACTGGGCCGCAGCCGGTGCAGGTAATAGTTGAGGTGACACACCGCGGAGA
TGGAGCGGTGGGTCTGCCAGGCCGAGAGACGGTCATCGCGTGGTGTGAGGTTGTCGACTCCGGGAACGGACGTTT
GGCCCGCCCTCCGAAGCAGGTCAGCGCATTTGCAAAGTCGCCACTCCTCGCACCCGGTGAGACGTGCACCGTGAG
CCTGTCAATCACCGCGTATGAGCTGGGGGTCTATGACCCGGAGCGCCAGAAATGGGTTCTCGACAAGGGGGCGCA
GTTTCGCATCTTGGTGGGCGCGGATGCGGCGCACACGCAGAAGGCAGGCACCATTCACGTACCGGAGACCATTAC
CTGGGTTCATCGCCTTGATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail