Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS95_1|g9535.t1
Gene name
Locationscaffold_095:102357..103079
Strand+
Gene length (bp)722
Transcript length (bp)495
Coding sequence length (bp)495
Protein length (aa) 165

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00933 Glyco_hydro_3 Glycosyl hydrolase family 3 N terminal domain 5.2E-18 66 162

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0008150 biological_process No
GO:0003824 catalytic activity No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0016787 hydrolase activity No
GO:0044238 primary metabolic process No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH3 5.8E-34 44 164

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID3
Orthogroup66
Change Orthofinder run
Species Protein ID
Aspergillus niger CBS 124.48 Ani_SJS7_1|g11109.t1
Aspergillus niger CBS 131.52 Ani_SJS8_1|g4980.t1
Aspergillus niger CBS 131.52 Ani_SJS8_1|g9167.t1
Aspergillus niger CBS 133816 Ani_SJS71_1|g10865.t1
Aspergillus niger CBS 147320 Ani_SJS28_1|g5050.t1
Aspergillus niger CBS 147321 Ani_SJS30_1|g6306.t1
Aspergillus niger CBS 147322 Ani_SJS35_1|g3639.t1
Aspergillus niger CBS 147322 Ani_SJS35_1|g7320.t1
Aspergillus niger CBS 147323 Ani_SJS38_1|g1486.t1
Aspergillus niger CBS 147323 Ani_SJS38_1|g1880.t1
Aspergillus niger CBS 147324 Ani_SJS39_1|g809.t1
Aspergillus niger CBS 147344 Ani_SJS70_1|g6133.t1
Aspergillus niger CBS 147344 Ani_SJS70_1|g10507.t1
Aspergillus niger CBS 147345 Ani_SJS72_1|g3900.t1
Aspergillus niger CBS 147345 Ani_SJS72_1|g1672.t1
Aspergillus niger CBS 147347 Ani_SJS76_1|g6247.t1
Aspergillus niger CBS 147347 Ani_SJS76_1|g3072.t1
Aspergillus niger CBS 147352 Ani_SJS95_1|g835.t1
Aspergillus niger CBS 147352 Ani_SJS95_1|g9536.t1
Aspergillus niger CBS 147352 Ani_SJS95_1|g9535.t1 (this protein)
Aspergillus niger CBS 147353 Ani_SJS100_1|g9300.t1
Aspergillus niger CBS 147353 Ani_SJS100_1|g5358.t1
Aspergillus niger CBS 147371 Ani_SJS27_1|g3651.t1
Aspergillus niger CBS 147482 Ani_SJS55_1|g3764.t1
Aspergillus niger CBS 147482 Ani_SJS55_1|g10814.t1
Aspergillus niger CBS 630.78 Ani_SJS18_1|g9368.t1
Aspergillus niger CBS 630.78 Ani_SJS18_1|g1298.t1
Aspergillus niger CBS 769.97 Ani_SJS82_1|g5691.t1
Aspergillus niger CBS 769.97 Ani_SJS82_1|g9954.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS95_1|g9535.t1
MAIIPPELDHFYASNMDLEVILRSLTLPEKVILLAGASTWRTAPVPRVNIPHLKLSDGPSGARGEIFGDSVPAAF
FPSGTSLGATWDEDLLGELGQILAEECKSKSASVILGPTMCIHRHPLGGRNFESYSEDPYLTGRLATATIRGIQS
RGIGATAKHYVAND*
Coding >Ani_SJS95_1|g9535.t1
ATGGCCATTATACCCCCTGAGCTCGATCACTTCTACGCGAGCAACATGGACCTGGAGGTTATTCTCCGCAGCTTG
ACGCTGCCAGAAAAAGTCATACTGCTTGCTGGGGCGTCAACCTGGCGAACTGCGCCGGTTCCGCGAGTCAACATC
CCTCATCTCAAGTTATCCGACGGTCCTTCTGGTGCTCGGGGGGAGATTTTCGGGGATAGCGTTCCTGCCGCCTTT
TTCCCGTCTGGTACCAGCTTGGGAGCCACTTGGGATGAAGACCTGCTGGGGGAGTTGGGACAGATTCTTGCCGAG
GAGTGTAAATCCAAGTCAGCTTCAGTAATCCTGGGGCCTACCATGTGCATTCATCGCCACCCACTGGGCGGCCGC
AATTTCGAATCCTACAGTGAAGACCCATACCTGACGGGGCGACTGGCGACCGCCACAATCCGGGGCATCCAATCC
CGGGGGATCGGGGCTACGGCCAAACACTACGTGGCCAATGATTAG
Transcript >Ani_SJS95_1|g9535.t1
ATGGCCATTATACCCCCTGAGCTCGATCACTTCTACGCGAGCAACATGGACCTGGAGGTTATTCTCCGCAGCTTG
ACGCTGCCAGAAAAAGTCATACTGCTTGCTGGGGCGTCAACCTGGCGAACTGCGCCGGTTCCGCGAGTCAACATC
CCTCATCTCAAGTTATCCGACGGTCCTTCTGGTGCTCGGGGGGAGATTTTCGGGGATAGCGTTCCTGCCGCCTTT
TTCCCGTCTGGTACCAGCTTGGGAGCCACTTGGGATGAAGACCTGCTGGGGGAGTTGGGACAGATTCTTGCCGAG
GAGTGTAAATCCAAGTCAGCTTCAGTAATCCTGGGGCCTACCATGTGCATTCATCGCCACCCACTGGGCGGCCGC
AATTTCGAATCCTACAGTGAAGACCCATACCTGACGGGGCGACTGGCGACCGCCACAATCCGGGGCATCCAATCC
CGGGGGATCGGGGCTACGGCCAAACACTACGTGGCCAATGATTAG
Gene >Ani_SJS95_1|g9535.t1
ATGGCCATTATACCCCCTGAGCTCGATCACTTCTACGCGAGCAACATGGACCTGGAGGTTATTCTCCGCAGCTTG
ACGCTGCCAGAAAAAGTCATACTGCTTGCTGGGGCGTCAACCTGGCGAACTGCGCCGGTTCCGCGAGTCAACATC
CCTCATCTCAAGGTAAGCTGGGTGACCATTGTTCCTCTTCCTACTGTATCCTGATCATTTTATGCTTTTATACGT
GTTGTGTTCTTCTTCCTCCCTTTTTTCCCTCCCTCTTTTTCTTTTCTTCTTCTTTCTTTCGGGGGTTGGGGGGTG
GGTTGGTTGCCCGCTAATCGAAGTACATCGTTTGTAGTTATCCGACGGTCCTTCTGGTGCTCGGGGGGAGATTTT
CGGGGATAGCGTTCCTGCCGCCTTTTTCCCGTCTGGTACCAGCTTGGGAGCCACTTGGGATGAAGACCTGCTGGG
GGAGTTGGGACAGATTCTTGCCGAGGAGGTCAGTTATGACTACTCCCTATCTTGTTATACCCACGACTCACGAGC
CACAGTGTAAATCCAAGTCAGCTTCAGTAATCCTGGGGCCTACCATGTGCATTCATCGCCACCCACTGGGCGGCC
GCAATTTCGAATCCTACAGTGAAGACCCATACCTGACGGGGCGACTGGCGACCGCCACAATCCGGGGCATCCAAT
CCCGGGGGATCGGGGCTACGGCCAAACACTACGTGGCCAATGATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail