Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS83_1|g6535.t1
Gene name
Locationscaffold_057:99910..108403
Strand-
Gene length (bp)8493
Transcript length (bp)7926
Coding sequence length (bp)7926
Protein length (aa) 2642

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 1.9E-66 2 248
PF08659 KR KR domain 6.8E-61 2257 2433
PF14765 PS-DH Polyketide synthase dehydratase 5.4E-44 998 1328
PF00698 Acyl_transf_1 Acyl transferase domain 2.7E-41 577 858
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 3.7E-34 257 374
PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase 3.8E-17 2097 2233
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 3.9E-17 2058 2164
PF16197 KAsynt_C_assoc Ketoacyl-synthetase C-terminal extension 5.1E-09 377 424
PF00106 adh_short short chain dehydrogenase 1.4E-09 2259 2409
PF08242 Methyltransf_12 Methyltransferase domain 2.3E-07 1525 1635
PF00550 PP-binding Phosphopantetheine attachment site 2.0E-06 2568 2632
PF08241 Methyltransf_11 Methyltransferase domain 2.2E-05 1561 1637
PF08240 ADH_N Alcohol dehydrogenase GroES-like domain 3.3E-05 1939 2000

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

Gene cluster ID Type of secondary metabolism gene
Cluster 40 PKS

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID3
Orthogroup8563
Change Orthofinder run
Species Protein ID
Aspergillus niger CBS 112.32 Ani_SJS6_1|g5878.t1
Aspergillus niger CBS 113.50 Ani_SJS3_1|g9772.t1
Aspergillus niger CBS 115988 Ani_SJS16_1|g6513.t1
Aspergillus niger CBS 115989 Ani_SJS83_1|g6535.t1 (this protein)
Aspergillus niger CBS 118.52 Ani_SJS14_1|g10090.t1
Aspergillus niger CBS 124.48 Ani_SJS7_1|g6768.t1
Aspergillus niger CBS 131.52 Ani_SJS8_1|g4734.t1
Aspergillus niger CBS 133816 Ani_SJS71_1|g6839.t1
Aspergillus niger CBS 147320 Ani_SJS28_1|g8666.t1
Aspergillus niger CBS 147321 Ani_SJS30_1|g5394.t1
Aspergillus niger CBS 147322 Ani_SJS35_1|g7474.t1
Aspergillus niger CBS 147323 Ani_SJS38_1|g2948.t1
Aspergillus niger CBS 147324 Ani_SJS39_1|g8587.t1
Aspergillus niger CBS 147343 Ani_SJS115_1|g7777.t1
Aspergillus niger CBS 147344 Ani_SJS70_1|g8078.t1
Aspergillus niger CBS 147345 Ani_SJS72_1|g7823.t1
Aspergillus niger CBS 147346 Ani_SJS75_1|g6708.t1
Aspergillus niger CBS 147347 Ani_SJS76_1|g6842.t1
Aspergillus niger CBS 147352 Ani_SJS95_1|g7679.t1
Aspergillus niger CBS 147353 Ani_SJS100_1|g8401.t1
Aspergillus niger CBS 147371 Ani_SJS27_1|g863.t1
Aspergillus niger CBS 147482 Ani_SJS55_1|g6588.t1
Aspergillus niger CBS 630.78 Ani_SJS18_1|g7132.t1
Aspergillus niger CBS 769.97 Ani_SJS82_1|g6108.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS83_1|g6535.t1
MQDIAIVGFSIKFPGDGDTPEGFWSMLAEKQCVMEEWPTERFNLEAFAGRSSKGFVRGAHFMKEDCGLFDAAFFG
ISGTEACAMDPQARLLLETAYRALENAGIPMEAVTGTKTAVINGCMADDYRHIIAHDPDVIPKYTAVGSTACMLA
NRLSWFFDLRGPSVNLDSACSSSLMALDLACQSLRNGDSNMALVTGSNILIGIEPILSLMNMSFNSPDGRCFSFD
ARANGYGRGEGVGVLVVKRLEDAVRDGDIIRAVVRSTGSNQDGHTPGLTQPSKDSQARLILDTYKKADLDRLETR
FFEAHGTGTAIGDPIEADAIGSVFRAFRSPEDPLYIGAVKSNIGHLEGGSGIAGIVKTILVLEKGLIPPNANFEH
LNPNIDAEFLNLRVPTDLIPWPTKGLRRASVASFGFGGSNSHAILDDAYHYLLERGLLSSASHCTIPDPSHSGTI
ENGLCRTTVEINGLEGSLASPTSEPKPADGLSSQLLIFSTSDEAGIQRMANAYTRYFQSLPSFRRGRDEEGSFVK
RLATMLAQRRSKLNWRSFAVADGSLDFLRDQLPSAISKPIRVNESKSLGLGYIFTGQGAQYRRMGVDLLKYPIYR
FTMDQCQEAYSSFGSEWSIYDALLDPHNTLDINDPKYAQPLTTALQIALVELLASFGLRPRMVIGHSSGEIAAAY
ALGALSLDSACKVSYFRGIFASRLRENAKVTTRRAGAMLAVDLSVSDAKPYLDRVKSELNIDNIHVACINSPHNV
TISGDAVAIDRFKSIVDSSTTTTIVSHRLRTGVAYHSPQMQQVATEYEYALANLRSQPDFNSRGTAGITMVSSVT
GMEVENVAVLLTARYWVQNMVSPVQFSAAMVQALVHSSVRKGRQQRPKRLGAVTHNVVISDWIEIGPHSALKRPF
RENLGLVDKKTQSPVVRYSSVLDRHSPAIQSLQTMAGNLFSLGYQLNLGEINQTHKGTGSGFEGIITNLPEYPFN
HTKRYWFEPEATKNIRLRPHKRHELLGAPFPDSTPLESRWRKIFDATETPWLLDHAVNGKAIYPATGMIVMAIEG
AQQLAEKGRVISGYFLHDSVFVNPIVIRPGGDKTVTHLHMRPSRQTQDQLSHAYDFQIYTEVGDRWQTNCRGQIS
IQYEGKSTGATIAEQQQQQQVTRADTVALQLQQEEAFYKEQWETARRECHMHVPTSKIYKTFQANGLHYGPSFQV
MDDLQWGGSNISIGTIKPFEWTAEQSENAPEPHMVHPSTLDGLGQLGWVALTQGGEKLVTTGLVSTRVREAWISG
AGASAEHIDTLHAVAHSRFKGLRGTDTSVYAVDSSGNLRLWISGMETTSMSSNNALVGEAQRRELCFSIDWKPDL
TLMNREQLREYCGQRPSHGETNGAGVRATNGLDCAEETDYLLMQYARRAVERYADRQARLNLPVHLQRYLEWLER
KLATTTCDTMQDRPGDQALEDRVLNQTSAGHLYVTFGRLLDSILDGDIEAGSILDGEQGTPEHAAVQHRQLLCDQ
ILDKDKALHRYIDALAHKTPQMRILEVNASTGSLAPQLISALTHHGVDGTETHRFSLYDYTDRSDRCLQEVPERL
AALGRKVAYRVLDIDQDPVAQGFDLASYDVVVSAWVSGHVQGLASFVRNARKLLKPGGTLLILDMVRGGSLRSGF
VFGTLPEWWEDTCSVQGWDSLLTSNGFSGVEISFPHDLGCNVMATTATGTMAINCSPPLKRTILVIDPESRLQAQ
VASILSDTSLGVGYAIDICSLSDMDTLSTSTDGSLVVMLPEIEQPFLVGLNGTTYKALHSLLCKAQDVVWITAGN
EESPHAPRRHLVDGLARVLCTENDRLSFITAHLEDHAANPAVWAKHIYQIMGTRLEQQATKASELDYREQDGLLH
IGRVAEAEELNDALFEQTQAPPKVRPFKQGPPLTCTIANPGSVESKAMLFVEDTEAIERPLGDDEVEIEVKAVGV
NFRDIFVLLGRLSDGDSIGTECSGIVTRVGAAATSDLKPGDRVCAVLLDCFRTLVRCHYQFVSKIPDALSFAAGA
AIPLGGVTAYHSLVQIARLRKGETVLIHSGAGGTGQMAIKVAQALGAKVFATVGSDDKRDLLERLYGIPKEHIFY
SRDTSFQRHVMRLTGGRGVDVVLNSLSGDGLIASWECVAPYGRFVELGKSDIQSNSKLPMRNFGRNVSFSVVAID
QMHYDRPYIIQESLGPVVEMVTAGTLQPAWPLQEFTLSSAEEAFRLMQSGKNVGKLVINMTPTDLVQTSIRHVPR
YSFPPEATYLIAGGLGGLGRSAARWMASMGAKNLILLSRSGPKATAAQELIRELTDQGVRVRAPRCDLTSSEALT
RALEECRDLPPIRGCIQGTMVLQDTIFESLTFSQWDTTLQSKVKSTENLHAQLPADLDFFILLSSLAGVIGHISQ
ANYAAGNTFQDAFAAYRRSLGQRAVALDLGWMREIGVAAEQEHLAMRVDAAPSMAGISEAEFLALLERCCDPAAN
PVTTTISSKPQILVGVVTPAQLRAHGHEIPTWLTERSMFQTLRQEATGPGETDGADNSPINPGGDTSPSNWHRAF
ARADSSSAAVTVVIEGLTRKLARSLSLTSPSEIDQQRSLALQGVDSLLAVEMRQWVSRAFAAEVSALDITSAPNL
EELAGMVVAYSEVKFD*
Coding >Ani_SJS83_1|g6535.t1
ATGCAAGACATCGCAATCGTGGGATTCTCCATCAAGTTTCCTGGCGATGGTGACACGCCGGAGGGGTTCTGGTCG
ATGCTAGCGGAAAAGCAATGTGTTATGGAGGAATGGCCGACAGAGCGGTTCAATCTAGAGGCCTTTGCTGGCCGC
AGCTCCAAGGGGTTTGTACGAGGTGCACATTTTATGAAAGAGGACTGTGGGTTATTCGATGCCGCATTTTTTGGC
ATTTCGGGGACCGAAGCGTGTGCCATGGATCCTCAAGCTCGCCTATTGCTGGAGACTGCATATCGGGCGCTGGAG
AATGCTGGGATACCTATGGAAGCCGTGACTGGTACGAAGACCGCGGTCATCAACGGCTGCATGGCCGACGACTAC
AGGCACATCATCGCGCACGACCCAGATGTTATCCCCAAGTACACAGCAGTAGGATCTACGGCGTGTATGCTCGCA
AATCGGCTGAGCTGGTTCTTCGATCTCCGGGGCCCCTCTGTGAACCTTGACTCAGCCTGTTCCAGCAGCCTGATG
GCGTTGGATCTGGCGTGCCAGAGTCTGCGAAACGGGGACTCGAACATGGCCCTGGTGACCGGATCTAACATTCTG
ATTGGCATTGAACCCATCCTTTCCCTCATGAACATGAGTTTCAACTCACCCGACGGCCGATGCTTTAGCTTCGAC
GCACGTGCCAACGGTTATGGGCGCGGTGAAGGAGTGGGTGTGTTGGTCGTCAAGCGGCTGGAGGATGCGGTACGT
GATGGAGACATCATCCGCGCCGTGGTCCGCTCTACGGGGTCGAACCAGGATGGCCACACACCAGGCTTAACCCAG
CCGAGTAAAGATTCCCAGGCCCGCTTGATCTTGGACACATACAAGAAAGCCGATTTGGATCGCCTGGAGACGAGA
TTCTTCGAAGCGCATGGGACTGGTACAGCGATAGGAGACCCCATCGAGGCCGATGCCATAGGAAGCGTCTTCCGA
GCCTTTCGCTCTCCGGAAGATCCTCTGTACATAGGAGCAGTGAAGTCGAACATTGGACATCTCGAAGGAGGCAGC
GGCATTGCTGGCATTGTCAAAACCATTCTAGTGTTAGAAAAAGGGCTCATTCCACCCAATGCCAACTTCGAGCAT
CTAAACCCCAACATCGATGCCGAGTTCCTCAACCTAAGGGTTCCCACTGATCTCATTCCGTGGCCAACAAAGGGG
CTACGGCGTGCCTCTGTGGCCTCTTTTGGCTTCGGGGGCTCGAATTCCCATGCCATTCTTGATGACGCCTACCAC
TATCTTCTCGAGCGCGGGCTGCTTTCCTCGGCCTCCCACTGCACTATCCCGGACCCTTCCCATAGTGGTACCATC
GAGAACGGGCTGTGCAGAACAACAGTCGAGATCAATGGATTGGAGGGGTCCCTTGCCTCGCCGACGTCCGAGCCA
AAACCAGCAGATGGATTGTCATCTCAACTTCTCATCTTCTCCACCTCAGACGAAGCAGGCATCCAGCGGATGGCA
AATGCTTACACGCGGTACTTCCAAAGCCTTCCATCCTTTCGCCGCGGTCGAGATGAAGAAGGTTCTTTCGTCAAA
CGATTAGCCACAATGTTGGCGCAAAGGAGAAGCAAGCTAAACTGGAGGTCCTTTGCAGTGGCTGATGGCTCACTT
GACTTCCTACGCGATCAATTGCCGTCCGCCATATCCAAGCCAATCCGTGTTAATGAAAGCAAATCATTGGGCTTG
GGGTATATATTCACGGGTCAGGGAGCGCAATATCGGCGAATGGGAGTAGACCTCCTCAAGTACCCCATCTATCGC
TTTACCATGGATCAATGCCAGGAGGCCTATAGCAGCTTTGGGAGCGAGTGGTCGATCTACGATGCTTTGCTCGAT
CCTCACAATACATTGGATATCAACGATCCCAAGTATGCGCAGCCCCTAACTACTGCATTGCAAATCGCTTTGGTG
GAACTGCTGGCATCCTTCGGACTGAGGCCACGAATGGTGATCGGTCATTCCTCGGGCGAAATCGCCGCCGCATAT
GCGCTGGGGGCATTATCGTTGGACTCTGCATGCAAGGTGTCGTATTTCCGAGGCATCTTTGCCAGCCGTCTGCGG
GAGAACGCCAAGGTTACCACCAGACGCGCAGGAGCCATGCTGGCCGTGGACCTTTCCGTGTCTGATGCAAAACCC
TACCTGGACCGCGTCAAATCGGAGCTGAACATCGACAACATTCACGTTGCGTGTATCAACAGCCCGCACAATGTG
ACAATATCGGGAGATGCAGTCGCAATCGATCGATTCAAATCCATTGTGGACAGCAGCACAACGACAACTATCGTG
TCGCACCGCCTGCGGACAGGGGTGGCATACCACAGCCCCCAAATGCAGCAGGTTGCGACAGAGTATGAGTACGCC
CTGGCTAATCTCAGGTCGCAACCTGACTTCAACAGCCGAGGTACAGCAGGGATAACAATGGTTTCGTCCGTCACT
GGCATGGAGGTCGAAAACGTGGCCGTTTTATTGACTGCGAGGTATTGGGTACAGAACATGGTGAGCCCGGTGCAG
TTCTCTGCCGCTATGGTCCAGGCACTCGTTCACTCTTCGGTGCGCAAGGGACGCCAACAAAGACCTAAGAGGTTG
GGCGCCGTCACACACAATGTGGTCATCAGTGACTGGATCGAAATTGGGCCTCATAGCGCCCTAAAACGGCCCTTT
CGTGAGAACTTGGGTCTGGTTGACAAGAAGACTCAAAGCCCGGTCGTCCGGTACTCCAGTGTTCTTGATCGGCAT
AGCCCGGCCATTCAATCCCTCCAGACAATGGCAGGCAACCTGTTTTCGCTTGGTTACCAGCTAAATTTGGGAGAG
ATCAATCAAACCCACAAAGGGACAGGATCGGGCTTTGAGGGGATCATCACCAACCTCCCCGAGTATCCTTTCAAT
CACACGAAGCGGTACTGGTTCGAACCAGAAGCCACGAAGAACATCCGACTCCGGCCACACAAAAGGCACGAGCTG
CTCGGAGCCCCTTTTCCGGATTCCACTCCACTGGAGAGCAGGTGGAGAAAGATATTTGATGCGACCGAAACTCCA
TGGCTACTGGATCATGCAGTAAATGGCAAGGCCATCTATCCAGCCACGGGCATGATCGTCATGGCCATCGAAGGG
GCCCAGCAGTTGGCCGAGAAAGGAAGAGTCATCTCCGGATACTTTCTACATGACTCCGTCTTTGTGAATCCCATA
GTCATTAGGCCAGGTGGCGACAAGACTGTGACGCATCTGCACATGAGGCCCTCGCGTCAGACCCAGGACCAGTTG
TCCCATGCTTATGACTTCCAAATCTACACAGAGGTGGGCGATCGGTGGCAGACAAACTGCCGCGGGCAAATCTCA
ATCCAGTATGAGGGTAAATCCACCGGTGCGACCATTGCGGAGCAGCAGCAGCAGCAGCAAGTGACAAGGGCGGAT
ACCGTGGCTCTGCAGTTGCAGCAAGAGGAGGCCTTCTACAAAGAGCAGTGGGAAACCGCTCGTCGAGAGTGCCAC
ATGCACGTGCCTACGAGCAAGATCTACAAGACCTTTCAAGCCAATGGGCTGCACTATGGACCATCGTTCCAAGTC
ATGGATGATCTACAGTGGGGGGGATCTAATATCTCGATCGGGACGATCAAGCCCTTCGAGTGGACCGCAGAGCAG
TCCGAAAATGCTCCAGAGCCGCACATGGTTCATCCCTCTACACTGGACGGTCTGGGTCAGCTAGGCTGGGTGGCC
CTTACGCAGGGAGGCGAGAAACTCGTCACCACAGGTCTAGTGTCGACTCGGGTGCGGGAGGCTTGGATATCTGGC
GCCGGGGCCTCCGCAGAGCACATTGACACCCTGCATGCTGTGGCACACAGCCGGTTCAAGGGTCTGCGAGGTACG
GACACCTCCGTATATGCCGTTGACAGCAGCGGTAACTTGCGGTTGTGGATCTCCGGGATGGAAACCACCTCCATG
TCTAGTAACAACGCGCTGGTGGGAGAGGCACAACGGAGAGAACTATGCTTCTCGATCGACTGGAAGCCAGATTTG
ACTCTAATGAATCGTGAGCAGCTACGGGAATACTGCGGTCAACGCCCTTCTCACGGGGAGACAAATGGGGCTGGA
GTCCGAGCCACCAATGGGCTCGACTGTGCAGAAGAGACCGATTATCTCCTTATGCAATACGCACGTCGAGCTGTG
GAAAGGTATGCCGACCGCCAAGCTAGATTAAACCTGCCTGTCCATCTGCAACGGTATCTTGAATGGCTGGAGCGC
AAGCTTGCCACTACGACCTGTGATACTATGCAAGACCGCCCTGGGGACCAAGCCCTTGAAGACCGCGTGTTGAAC
CAGACCTCGGCGGGGCATTTGTACGTCACTTTCGGAAGATTGCTGGATTCGATTCTTGACGGGGATATTGAGGCC
GGCTCAATCCTGGATGGCGAACAAGGAACGCCGGAGCATGCTGCTGTGCAGCATCGTCAACTCCTTTGCGACCAG
ATCTTGGATAAGGACAAGGCTCTGCACCGTTACATCGATGCGTTGGCCCACAAAACCCCGCAAATGAGGATTCTA
GAAGTCAACGCCAGCACCGGCTCGCTGGCCCCGCAATTGATAAGTGCTTTAACACACCATGGTGTAGATGGAACA
GAGACGCATCGCTTCTCACTTTACGATTACACTGACAGATCGGACCGATGTCTTCAGGAAGTCCCAGAGCGCTTA
GCCGCACTAGGTCGCAAAGTCGCATACAGAGTACTCGATATCGATCAAGACCCAGTAGCGCAAGGATTTGACCTT
GCTAGCTATGATGTGGTTGTGTCTGCATGGGTCTCTGGTCATGTCCAAGGCCTGGCTTCCTTTGTCAGAAACGCT
CGGAAACTACTCAAACCCGGCGGCACACTCCTGATCCTAGACATGGTCCGAGGAGGTTCATTGAGATCGGGCTTT
GTATTCGGAACCCTACCGGAATGGTGGGAAGACACATGCTCAGTACAAGGCTGGGACAGTCTGCTCACCTCCAAC
GGCTTTTCAGGAGTTGAAATCTCGTTTCCGCATGATTTGGGGTGCAATGTTATGGCTACAACAGCAACCGGCACT
ATGGCCATAAACTGCAGTCCTCCTCTGAAGCGGACTATCCTCGTCATTGATCCTGAATCCCGCTTACAAGCCCAG
GTAGCGAGCATATTATCAGATACGAGCCTCGGAGTTGGATACGCCATTGATATTTGCTCGCTCAGCGATATGGAC
ACGTTATCGACATCCACGGACGGCTCTTTGGTGGTCATGCTCCCTGAGATAGAACAGCCTTTCCTGGTCGGTCTC
AATGGAACCACTTATAAAGCCCTCCACAGCCTCCTCTGTAAAGCCCAAGACGTTGTTTGGATTACTGCTGGAAAC
GAGGAGTCGCCTCACGCACCCCGGCGTCACTTAGTTGATGGCCTGGCGAGAGTGCTGTGCACTGAGAATGATCGA
CTCTCCTTTATCACCGCACACTTGGAAGACCATGCCGCCAACCCTGCCGTGTGGGCAAAACATATCTATCAGATC
ATGGGCACGAGACTCGAGCAACAGGCTACCAAGGCCAGTGAGCTCGATTACCGAGAGCAGGATGGATTGCTGCAC
ATCGGTCGCGTGGCTGAAGCAGAAGAGTTAAATGATGCTCTGTTTGAACAAACGCAGGCCCCGCCTAAGGTGCGT
CCGTTCAAACAGGGCCCTCCATTGACCTGTACGATCGCGAACCCGGGGTCAGTGGAGAGCAAAGCGATGCTCTTT
GTTGAAGACACCGAGGCCATCGAGCGCCCACTCGGTGATGATGAAGTGGAAATCGAGGTGAAAGCGGTGGGGGTC
AACTTCCGCGATATCTTTGTCCTGCTGGGCCGGCTCAGTGACGGCGACAGCATCGGTACAGAATGCTCAGGGATT
GTGACTCGGGTGGGTGCGGCAGCAACTTCGGACCTGAAGCCAGGAGACCGGGTCTGTGCCGTCCTCCTCGACTGT
TTCCGCACCCTGGTTCGTTGTCACTACCAATTTGTTTCGAAGATCCCGGATGCCCTGAGTTTTGCCGCGGGCGCA
GCGATCCCCCTCGGCGGCGTGACTGCATATCATTCCCTGGTGCAGATCGCACGGTTACGGAAGGGAGAGACAGTG
CTCATTCACTCGGGGGCTGGGGGTACTGGGCAAATGGCCATCAAAGTTGCCCAAGCCCTGGGGGCCAAGGTCTTT
GCCACGGTCGGCTCAGACGACAAACGGGACTTGCTTGAGCGGCTGTATGGCATTCCCAAGGAGCATATATTCTAC
AGTCGAGACACGTCGTTCCAGCGCCATGTTATGCGATTGACTGGTGGCCGTGGTGTGGATGTCGTGCTGAACTCG
CTCTCCGGCGATGGCCTCATTGCCTCGTGGGAGTGCGTCGCCCCGTACGGACGGTTCGTGGAACTGGGCAAGTCC
GATATTCAATCAAACTCCAAGCTGCCAATGCGCAACTTCGGGCGCAACGTCTCCTTCTCGGTAGTAGCCATCGAC
CAGATGCATTATGACCGACCGTATATCATCCAGGAATCGCTGGGGCCGGTCGTGGAGATGGTCACGGCTGGCACA
CTGCAGCCCGCCTGGCCACTTCAGGAATTCACCCTCTCATCGGCAGAGGAAGCATTCCGCTTGATGCAAAGCGGC
AAAAATGTGGGCAAGTTGGTGATCAACATGACCCCCACCGACCTCGTACAGACGTCCATTCGACATGTCCCCAGA
TATTCATTCCCCCCCGAGGCAACGTACTTGATTGCCGGTGGACTCGGGGGCCTAGGGCGAAGCGCCGCTCGATGG
ATGGCATCCATGGGGGCGAAGAATCTGATTCTGCTGTCTCGATCGGGTCCCAAGGCAACCGCAGCACAAGAGCTT
ATTCGGGAACTCACCGATCAGGGAGTTCGCGTCCGGGCTCCCCGGTGTGACCTGACTTCTTCCGAGGCGTTGACT
CGGGCTCTAGAGGAGTGCCGGGACCTGCCTCCGATTCGAGGGTGTATCCAAGGAACAATGGTTTTGCAGGACACG
ATCTTCGAAAGTCTGACCTTCAGTCAGTGGGATACTACTCTCCAGTCCAAGGTGAAAAGTACGGAGAACCTGCAC
GCGCAGCTCCCTGCCGATCTCGACTTCTTCATTCTTCTCTCCTCGCTTGCCGGTGTCATTGGCCACATTTCACAA
GCCAACTACGCAGCGGGGAATACCTTTCAGGATGCATTTGCGGCCTACCGTCGGTCTCTGGGTCAGCGCGCGGTC
GCGCTCGATCTGGGATGGATGCGCGAGATTGGAGTTGCTGCTGAGCAAGAACACTTGGCCATGCGCGTGGATGCG
GCCCCCAGTATGGCTGGGATCAGCGAGGCCGAGTTCCTGGCCCTCCTGGAGCGGTGCTGTGATCCTGCGGCGAAT
CCAGTCACCACGACCATTAGCAGCAAACCACAGATTCTCGTCGGAGTGGTTACACCGGCACAGCTTCGGGCTCAT
GGCCACGAGATACCAACGTGGCTAACCGAACGCAGCATGTTCCAAACTCTCCGGCAAGAAGCGACGGGACCAGGG
GAGACCGACGGCGCAGATAACAGTCCCATCAACCCCGGCGGCGACACCTCACCCAGCAATTGGCACCGGGCATTT
GCGAGGGCAGATTCATCCTCAGCCGCGGTCACCGTGGTGATCGAAGGGTTGACGCGAAAACTTGCACGGTCATTG
AGTCTGACTTCGCCATCCGAGATCGACCAGCAGCGCTCGCTGGCTCTACAAGGGGTGGACTCGTTGCTGGCGGTG
GAGATGCGCCAATGGGTCTCGCGGGCGTTTGCGGCCGAGGTTTCAGCGCTAGATATCACGAGTGCGCCGAATCTG
GAGGAGTTGGCGGGAATGGTGGTTGCGTATAGTGAGGTGAAATTCGATTGA
Transcript >Ani_SJS83_1|g6535.t1
ATGCAAGACATCGCAATCGTGGGATTCTCCATCAAGTTTCCTGGCGATGGTGACACGCCGGAGGGGTTCTGGTCG
ATGCTAGCGGAAAAGCAATGTGTTATGGAGGAATGGCCGACAGAGCGGTTCAATCTAGAGGCCTTTGCTGGCCGC
AGCTCCAAGGGGTTTGTACGAGGTGCACATTTTATGAAAGAGGACTGTGGGTTATTCGATGCCGCATTTTTTGGC
ATTTCGGGGACCGAAGCGTGTGCCATGGATCCTCAAGCTCGCCTATTGCTGGAGACTGCATATCGGGCGCTGGAG
AATGCTGGGATACCTATGGAAGCCGTGACTGGTACGAAGACCGCGGTCATCAACGGCTGCATGGCCGACGACTAC
AGGCACATCATCGCGCACGACCCAGATGTTATCCCCAAGTACACAGCAGTAGGATCTACGGCGTGTATGCTCGCA
AATCGGCTGAGCTGGTTCTTCGATCTCCGGGGCCCCTCTGTGAACCTTGACTCAGCCTGTTCCAGCAGCCTGATG
GCGTTGGATCTGGCGTGCCAGAGTCTGCGAAACGGGGACTCGAACATGGCCCTGGTGACCGGATCTAACATTCTG
ATTGGCATTGAACCCATCCTTTCCCTCATGAACATGAGTTTCAACTCACCCGACGGCCGATGCTTTAGCTTCGAC
GCACGTGCCAACGGTTATGGGCGCGGTGAAGGAGTGGGTGTGTTGGTCGTCAAGCGGCTGGAGGATGCGGTACGT
GATGGAGACATCATCCGCGCCGTGGTCCGCTCTACGGGGTCGAACCAGGATGGCCACACACCAGGCTTAACCCAG
CCGAGTAAAGATTCCCAGGCCCGCTTGATCTTGGACACATACAAGAAAGCCGATTTGGATCGCCTGGAGACGAGA
TTCTTCGAAGCGCATGGGACTGGTACAGCGATAGGAGACCCCATCGAGGCCGATGCCATAGGAAGCGTCTTCCGA
GCCTTTCGCTCTCCGGAAGATCCTCTGTACATAGGAGCAGTGAAGTCGAACATTGGACATCTCGAAGGAGGCAGC
GGCATTGCTGGCATTGTCAAAACCATTCTAGTGTTAGAAAAAGGGCTCATTCCACCCAATGCCAACTTCGAGCAT
CTAAACCCCAACATCGATGCCGAGTTCCTCAACCTAAGGGTTCCCACTGATCTCATTCCGTGGCCAACAAAGGGG
CTACGGCGTGCCTCTGTGGCCTCTTTTGGCTTCGGGGGCTCGAATTCCCATGCCATTCTTGATGACGCCTACCAC
TATCTTCTCGAGCGCGGGCTGCTTTCCTCGGCCTCCCACTGCACTATCCCGGACCCTTCCCATAGTGGTACCATC
GAGAACGGGCTGTGCAGAACAACAGTCGAGATCAATGGATTGGAGGGGTCCCTTGCCTCGCCGACGTCCGAGCCA
AAACCAGCAGATGGATTGTCATCTCAACTTCTCATCTTCTCCACCTCAGACGAAGCAGGCATCCAGCGGATGGCA
AATGCTTACACGCGGTACTTCCAAAGCCTTCCATCCTTTCGCCGCGGTCGAGATGAAGAAGGTTCTTTCGTCAAA
CGATTAGCCACAATGTTGGCGCAAAGGAGAAGCAAGCTAAACTGGAGGTCCTTTGCAGTGGCTGATGGCTCACTT
GACTTCCTACGCGATCAATTGCCGTCCGCCATATCCAAGCCAATCCGTGTTAATGAAAGCAAATCATTGGGCTTG
GGGTATATATTCACGGGTCAGGGAGCGCAATATCGGCGAATGGGAGTAGACCTCCTCAAGTACCCCATCTATCGC
TTTACCATGGATCAATGCCAGGAGGCCTATAGCAGCTTTGGGAGCGAGTGGTCGATCTACGATGCTTTGCTCGAT
CCTCACAATACATTGGATATCAACGATCCCAAGTATGCGCAGCCCCTAACTACTGCATTGCAAATCGCTTTGGTG
GAACTGCTGGCATCCTTCGGACTGAGGCCACGAATGGTGATCGGTCATTCCTCGGGCGAAATCGCCGCCGCATAT
GCGCTGGGGGCATTATCGTTGGACTCTGCATGCAAGGTGTCGTATTTCCGAGGCATCTTTGCCAGCCGTCTGCGG
GAGAACGCCAAGGTTACCACCAGACGCGCAGGAGCCATGCTGGCCGTGGACCTTTCCGTGTCTGATGCAAAACCC
TACCTGGACCGCGTCAAATCGGAGCTGAACATCGACAACATTCACGTTGCGTGTATCAACAGCCCGCACAATGTG
ACAATATCGGGAGATGCAGTCGCAATCGATCGATTCAAATCCATTGTGGACAGCAGCACAACGACAACTATCGTG
TCGCACCGCCTGCGGACAGGGGTGGCATACCACAGCCCCCAAATGCAGCAGGTTGCGACAGAGTATGAGTACGCC
CTGGCTAATCTCAGGTCGCAACCTGACTTCAACAGCCGAGGTACAGCAGGGATAACAATGGTTTCGTCCGTCACT
GGCATGGAGGTCGAAAACGTGGCCGTTTTATTGACTGCGAGGTATTGGGTACAGAACATGGTGAGCCCGGTGCAG
TTCTCTGCCGCTATGGTCCAGGCACTCGTTCACTCTTCGGTGCGCAAGGGACGCCAACAAAGACCTAAGAGGTTG
GGCGCCGTCACACACAATGTGGTCATCAGTGACTGGATCGAAATTGGGCCTCATAGCGCCCTAAAACGGCCCTTT
CGTGAGAACTTGGGTCTGGTTGACAAGAAGACTCAAAGCCCGGTCGTCCGGTACTCCAGTGTTCTTGATCGGCAT
AGCCCGGCCATTCAATCCCTCCAGACAATGGCAGGCAACCTGTTTTCGCTTGGTTACCAGCTAAATTTGGGAGAG
ATCAATCAAACCCACAAAGGGACAGGATCGGGCTTTGAGGGGATCATCACCAACCTCCCCGAGTATCCTTTCAAT
CACACGAAGCGGTACTGGTTCGAACCAGAAGCCACGAAGAACATCCGACTCCGGCCACACAAAAGGCACGAGCTG
CTCGGAGCCCCTTTTCCGGATTCCACTCCACTGGAGAGCAGGTGGAGAAAGATATTTGATGCGACCGAAACTCCA
TGGCTACTGGATCATGCAGTAAATGGCAAGGCCATCTATCCAGCCACGGGCATGATCGTCATGGCCATCGAAGGG
GCCCAGCAGTTGGCCGAGAAAGGAAGAGTCATCTCCGGATACTTTCTACATGACTCCGTCTTTGTGAATCCCATA
GTCATTAGGCCAGGTGGCGACAAGACTGTGACGCATCTGCACATGAGGCCCTCGCGTCAGACCCAGGACCAGTTG
TCCCATGCTTATGACTTCCAAATCTACACAGAGGTGGGCGATCGGTGGCAGACAAACTGCCGCGGGCAAATCTCA
ATCCAGTATGAGGGTAAATCCACCGGTGCGACCATTGCGGAGCAGCAGCAGCAGCAGCAAGTGACAAGGGCGGAT
ACCGTGGCTCTGCAGTTGCAGCAAGAGGAGGCCTTCTACAAAGAGCAGTGGGAAACCGCTCGTCGAGAGTGCCAC
ATGCACGTGCCTACGAGCAAGATCTACAAGACCTTTCAAGCCAATGGGCTGCACTATGGACCATCGTTCCAAGTC
ATGGATGATCTACAGTGGGGGGGATCTAATATCTCGATCGGGACGATCAAGCCCTTCGAGTGGACCGCAGAGCAG
TCCGAAAATGCTCCAGAGCCGCACATGGTTCATCCCTCTACACTGGACGGTCTGGGTCAGCTAGGCTGGGTGGCC
CTTACGCAGGGAGGCGAGAAACTCGTCACCACAGGTCTAGTGTCGACTCGGGTGCGGGAGGCTTGGATATCTGGC
GCCGGGGCCTCCGCAGAGCACATTGACACCCTGCATGCTGTGGCACACAGCCGGTTCAAGGGTCTGCGAGGTACG
GACACCTCCGTATATGCCGTTGACAGCAGCGGTAACTTGCGGTTGTGGATCTCCGGGATGGAAACCACCTCCATG
TCTAGTAACAACGCGCTGGTGGGAGAGGCACAACGGAGAGAACTATGCTTCTCGATCGACTGGAAGCCAGATTTG
ACTCTAATGAATCGTGAGCAGCTACGGGAATACTGCGGTCAACGCCCTTCTCACGGGGAGACAAATGGGGCTGGA
GTCCGAGCCACCAATGGGCTCGACTGTGCAGAAGAGACCGATTATCTCCTTATGCAATACGCACGTCGAGCTGTG
GAAAGGTATGCCGACCGCCAAGCTAGATTAAACCTGCCTGTCCATCTGCAACGGTATCTTGAATGGCTGGAGCGC
AAGCTTGCCACTACGACCTGTGATACTATGCAAGACCGCCCTGGGGACCAAGCCCTTGAAGACCGCGTGTTGAAC
CAGACCTCGGCGGGGCATTTGTACGTCACTTTCGGAAGATTGCTGGATTCGATTCTTGACGGGGATATTGAGGCC
GGCTCAATCCTGGATGGCGAACAAGGAACGCCGGAGCATGCTGCTGTGCAGCATCGTCAACTCCTTTGCGACCAG
ATCTTGGATAAGGACAAGGCTCTGCACCGTTACATCGATGCGTTGGCCCACAAAACCCCGCAAATGAGGATTCTA
GAAGTCAACGCCAGCACCGGCTCGCTGGCCCCGCAATTGATAAGTGCTTTAACACACCATGGTGTAGATGGAACA
GAGACGCATCGCTTCTCACTTTACGATTACACTGACAGATCGGACCGATGTCTTCAGGAAGTCCCAGAGCGCTTA
GCCGCACTAGGTCGCAAAGTCGCATACAGAGTACTCGATATCGATCAAGACCCAGTAGCGCAAGGATTTGACCTT
GCTAGCTATGATGTGGTTGTGTCTGCATGGGTCTCTGGTCATGTCCAAGGCCTGGCTTCCTTTGTCAGAAACGCT
CGGAAACTACTCAAACCCGGCGGCACACTCCTGATCCTAGACATGGTCCGAGGAGGTTCATTGAGATCGGGCTTT
GTATTCGGAACCCTACCGGAATGGTGGGAAGACACATGCTCAGTACAAGGCTGGGACAGTCTGCTCACCTCCAAC
GGCTTTTCAGGAGTTGAAATCTCGTTTCCGCATGATTTGGGGTGCAATGTTATGGCTACAACAGCAACCGGCACT
ATGGCCATAAACTGCAGTCCTCCTCTGAAGCGGACTATCCTCGTCATTGATCCTGAATCCCGCTTACAAGCCCAG
GTAGCGAGCATATTATCAGATACGAGCCTCGGAGTTGGATACGCCATTGATATTTGCTCGCTCAGCGATATGGAC
ACGTTATCGACATCCACGGACGGCTCTTTGGTGGTCATGCTCCCTGAGATAGAACAGCCTTTCCTGGTCGGTCTC
AATGGAACCACTTATAAAGCCCTCCACAGCCTCCTCTGTAAAGCCCAAGACGTTGTTTGGATTACTGCTGGAAAC
GAGGAGTCGCCTCACGCACCCCGGCGTCACTTAGTTGATGGCCTGGCGAGAGTGCTGTGCACTGAGAATGATCGA
CTCTCCTTTATCACCGCACACTTGGAAGACCATGCCGCCAACCCTGCCGTGTGGGCAAAACATATCTATCAGATC
ATGGGCACGAGACTCGAGCAACAGGCTACCAAGGCCAGTGAGCTCGATTACCGAGAGCAGGATGGATTGCTGCAC
ATCGGTCGCGTGGCTGAAGCAGAAGAGTTAAATGATGCTCTGTTTGAACAAACGCAGGCCCCGCCTAAGGTGCGT
CCGTTCAAACAGGGCCCTCCATTGACCTGTACGATCGCGAACCCGGGGTCAGTGGAGAGCAAAGCGATGCTCTTT
GTTGAAGACACCGAGGCCATCGAGCGCCCACTCGGTGATGATGAAGTGGAAATCGAGGTGAAAGCGGTGGGGGTC
AACTTCCGCGATATCTTTGTCCTGCTGGGCCGGCTCAGTGACGGCGACAGCATCGGTACAGAATGCTCAGGGATT
GTGACTCGGGTGGGTGCGGCAGCAACTTCGGACCTGAAGCCAGGAGACCGGGTCTGTGCCGTCCTCCTCGACTGT
TTCCGCACCCTGGTTCGTTGTCACTACCAATTTGTTTCGAAGATCCCGGATGCCCTGAGTTTTGCCGCGGGCGCA
GCGATCCCCCTCGGCGGCGTGACTGCATATCATTCCCTGGTGCAGATCGCACGGTTACGGAAGGGAGAGACAGTG
CTCATTCACTCGGGGGCTGGGGGTACTGGGCAAATGGCCATCAAAGTTGCCCAAGCCCTGGGGGCCAAGGTCTTT
GCCACGGTCGGCTCAGACGACAAACGGGACTTGCTTGAGCGGCTGTATGGCATTCCCAAGGAGCATATATTCTAC
AGTCGAGACACGTCGTTCCAGCGCCATGTTATGCGATTGACTGGTGGCCGTGGTGTGGATGTCGTGCTGAACTCG
CTCTCCGGCGATGGCCTCATTGCCTCGTGGGAGTGCGTCGCCCCGTACGGACGGTTCGTGGAACTGGGCAAGTCC
GATATTCAATCAAACTCCAAGCTGCCAATGCGCAACTTCGGGCGCAACGTCTCCTTCTCGGTAGTAGCCATCGAC
CAGATGCATTATGACCGACCGTATATCATCCAGGAATCGCTGGGGCCGGTCGTGGAGATGGTCACGGCTGGCACA
CTGCAGCCCGCCTGGCCACTTCAGGAATTCACCCTCTCATCGGCAGAGGAAGCATTCCGCTTGATGCAAAGCGGC
AAAAATGTGGGCAAGTTGGTGATCAACATGACCCCCACCGACCTCGTACAGACGTCCATTCGACATGTCCCCAGA
TATTCATTCCCCCCCGAGGCAACGTACTTGATTGCCGGTGGACTCGGGGGCCTAGGGCGAAGCGCCGCTCGATGG
ATGGCATCCATGGGGGCGAAGAATCTGATTCTGCTGTCTCGATCGGGTCCCAAGGCAACCGCAGCACAAGAGCTT
ATTCGGGAACTCACCGATCAGGGAGTTCGCGTCCGGGCTCCCCGGTGTGACCTGACTTCTTCCGAGGCGTTGACT
CGGGCTCTAGAGGAGTGCCGGGACCTGCCTCCGATTCGAGGGTGTATCCAAGGAACAATGGTTTTGCAGGACACG
ATCTTCGAAAGTCTGACCTTCAGTCAGTGGGATACTACTCTCCAGTCCAAGGTGAAAAGTACGGAGAACCTGCAC
GCGCAGCTCCCTGCCGATCTCGACTTCTTCATTCTTCTCTCCTCGCTTGCCGGTGTCATTGGCCACATTTCACAA
GCCAACTACGCAGCGGGGAATACCTTTCAGGATGCATTTGCGGCCTACCGTCGGTCTCTGGGTCAGCGCGCGGTC
GCGCTCGATCTGGGATGGATGCGCGAGATTGGAGTTGCTGCTGAGCAAGAACACTTGGCCATGCGCGTGGATGCG
GCCCCCAGTATGGCTGGGATCAGCGAGGCCGAGTTCCTGGCCCTCCTGGAGCGGTGCTGTGATCCTGCGGCGAAT
CCAGTCACCACGACCATTAGCAGCAAACCACAGATTCTCGTCGGAGTGGTTACACCGGCACAGCTTCGGGCTCAT
GGCCACGAGATACCAACGTGGCTAACCGAACGCAGCATGTTCCAAACTCTCCGGCAAGAAGCGACGGGACCAGGG
GAGACCGACGGCGCAGATAACAGTCCCATCAACCCCGGCGGCGACACCTCACCCAGCAATTGGCACCGGGCATTT
GCGAGGGCAGATTCATCCTCAGCCGCGGTCACCGTGGTGATCGAAGGGTTGACGCGAAAACTTGCACGGTCATTG
AGTCTGACTTCGCCATCCGAGATCGACCAGCAGCGCTCGCTGGCTCTACAAGGGGTGGACTCGTTGCTGGCGGTG
GAGATGCGCCAATGGGTCTCGCGGGCGTTTGCGGCCGAGGTTTCAGCGCTAGATATCACGAGTGCGCCGAATCTG
GAGGAGTTGGCGGGAATGGTGGTTGCGTATAGTGAGGTGAAATTCGATTGA
Gene >Ani_SJS83_1|g6535.t1
ATGCAAGACATCGCAATCGTGGGATTCTCCATCAAGTTTCCTGGCGATGGTGACACGCCGGAGGGGTTCTGGTCG
ATGCTAGCGGAAAAGCAATGTGTTATGGAGGAATGGCCGACAGAGCGGTTCAATCTAGAGGCCTTTGCTGGCCGC
AGCTCCAAGGTGATTTCACCTAAAGCACCCCTACAATTCCCTACCTCTGGTCCAAGATACCTGACCGCCGATGAC
AGGGGTTTGTACGAGGTGCACATTTTATGAAAGAGGACTGTGGGTTATTCGATGCCGCATTTTTTGGCATTTCGG
GGACCGAAGCGTGTGCCATGGATCCTCAAGCTCGCCTATTGCTGGAGACTGCATATCGGGCGCTGGAGAATGGTA
TGTACGACAAAGTTTCCCCCCTAGATGTCTATGCCTCAGCAGAGCCTATAGACAGGGGTTAACAGTTGCCGATAT
AGCTGGGATACCTATGGAAGCCGTGACTGGTACGAAGACCGCGGTCATCAACGGCTGCATGGCCGACGACTACAG
GCACATCATCGCGCACGACCCAGATGTTATCCCCAAGTACACAGCAGTAGGATCTACGGCGTGTATGCTCGCAAA
TCGGCTGAGCTGGTTCTTCGATCTCCGGGGCCCCTCTGTGAACCTTGACTCAGCCTGTTCCAGCAGCCTGATGGC
GTTGGATCTGGCGTGCCAGAGTCTGCGAAACGGGGACTCGAACATGGCCCTGGTGACCGGATCTAACATTCTGAT
TGGCATTGAACCCATCCTTTCCCTCATGAACATGAGTTTCAACTCACCCGACGGCCGATGCTTTAGCTTCGACGC
ACGTGCCAACGGTTATGGGCGCGGTGAAGGAGTGGGTGTGTTGGTCGTCAAGCGGCTGGAGGATGCGGTACGTGA
TGGAGACATCATCCGCGCCGTGGTCCGCTCTACGGGGTCGAACCAGGATGGCCACACACCAGGCTTAACCCAGCC
GAGTAAAGATTCCCAGGCCCGCTTGATCTTGGACACATACAAGAAAGCCGATTTGGATCGCCTGGAGACGAGATT
CTTCGAAGCGCATGGTAAGCTTTGTCCAAAGGAGTACTTCACAGCTCCTAGTGCATAATGCCTGAAATGATATCG
CTGACCAGCTATGTTTACCGTTTCACAGGGACTGGTACAGCGATAGGAGACCCCATCGAGGCCGATGCCATAGGA
AGCGTCTTCCGAGCCTTTCGCTCTCCGGAAGATCCTCTGTACATGTGAGTTGCGGTCTACATCACTCAGGCATCA
CTTACTCACATCTTGAAACAGAGGAGCAGTGAAGTCGAACATTGGACATCTCGAAGGAGGCAGCGGCATTGCTGG
CATTGTCAAAACCATTCTAGTGTTAGAAAAAGGGCTCATTCCACCCAATGCCAACTTCGAGCATCTAAACCCCAA
CATCGATGCCGAGTTCCTCAACCTAAGGGTTCCCACTGATCTCATTCCGTGGCCAACAAAGGGGCTACGGCGTGC
CTCTGTGGCCTCTTTTGGCTTCGGGGGCTCGAATTCCCATGCCATTCTTGATGACGCCTACCACTATCTTCTCGA
GCGCGGGCTGCTTTCCTCGGCCTCCCACTGCACTATCCCGGACCCTTCCCATAGTGGTACCATCGAGAACGGGCT
GTGCAGAACAACAGTCGAGATCAATGGATTGGAGGGGTCCCTTGCCTCGCCGACGTCCGAGCCAAAACCAGCAGA
TGGATTGTCATCTCAACTTCTCATCTTCTCCACCTCAGACGAAGCAGGCATCCAGCGGATGGCAAATGCTTACAC
GCGGTACTTCCAAAGCCTTCCATCCTTTCGCCGCGGTCGAGATGAAGAAGGTTCTTTCGTCAAACGATTAGCCAC
AATGTTGGCGCAAAGGAGAAGCAAGCTAAACTGGAGGTCCTTTGCAGTGGCTGATGGCTCACTTGACTTCCTACG
CGATCAATTGCCGTCCGCCATATCCAAGCCAATCCGTGTTAATGAAAGCAAATCATTGGGCTTGGGGTATATATT
CACGGGTCAGGGAGCGCAATATCGGCGAATGGGAGTAGACCTCCTCAAGTACCCCATCTATCGCTTTACCATGGA
TCAATGCCAGGAGGCCTATAGCAGCTTTGGGAGCGAGTGGTCGATCTACGGTCAGTGCCCTCTGTTTCCATGATA
AATCTTCTTGGCCTTCCCTACGACAGTTTGAGGCCTGGAATCAATTGCTGATTCATGTTGCTATTATCCAGATGC
TTTGCTCGATCCTCACAATACATTGGATATCAACGATCCCAAGTATGCGCAGCCCCTAACTACTGCATTGCAAAT
CGCTTTGGTGGAACTGCTGGCATCCTTCGGACTGAGGCCACGAATGGTGATCGGTCATTCCTCGGGCGAAATCGC
CGCCGCATATGCGCTGGGGGCATTATCGTTGGACTCTGCATGCAAGGTGTCGTATTTCCGAGGCATCTTTGCCAG
CCGTCTGCGGGAGAACGCCAAGGTTACCACCAGACGCGCAGGAGCCATGCTGGCCGTGGACCTTTCCGTGTCTGA
TGCAAAACCCTACCTGGACCGCGTCAAATCGGAGCTGAACATCGACAACATTCACGTTGCGTGTATCAACAGCCC
GCACAATGTGACAATATCGGGAGATGCAGTCGCAATCGATCGATTCAAATCCATTGTGGACAGCAGCACAACGAC
AACTATCGTGTCGCACCGCCTGCGGACAGGGGTGGCATACCACAGCCCCCAAATGCAGCAGGTTGCGACAGAGTA
TGAGTACGCCCTGGCTAATCTCAGGTCGCAACCTGACTTCAACAGCCGAGGTACAGCAGGGATAACAATGGTTTC
GTCCGTCACTGGCATGGAGGTCGAAAACGTGGCCGTTTTATTGACTGCGAGGTATTGGGTACAGAACATGGTGAG
CCCGGTGCAGTTCTCTGCCGCTATGGTCCAGGCACTCGTTCACTCTTCGGTGCGCAAGGGACGCCAACAAAGACC
TAAGAGGTTGGGCGCCGTCACACACAATGTGGTCATCAGTGACTGGATCGAAATTGGGCCTCATAGCGCCCTAAA
ACGGCCCTTTCGTGAGAACTTGGGTCTGGTTGACAAGAAGACTCAAAGCCCGGTCGTCCGGTACTCCAGTGTTCT
TGATCGGCATAGCCCGGCCATTCAATCCCTCCAGACAATGGCAGGCAACCTGTTTTCGCTTGGTTACCAGCTAAA
TTTGGGAGAGATCAATCAAACCCACAAAGGGACAGGATCGGGCTTTGAGGGGATCATCACCAACCTCCCCGAGTA
TCCTTTCAATCACACGAAGCGGTACTGGTTCGAACCAGAAGCCACGAAGAACATCCGACTCCGGCCACACAAAAG
GCACGAGCTGCTCGGAGCCCCTTTTCCGGATTCCACTCCACTGGAGAGCAGGTGGAGAAAGATATTTGATGCGAC
CGAAACTCCATGGCTACTGGATCATGCAGTAAATGGCAAGGCCATCTATCCAGCCACGGGCATGATCGTCATGGC
CATCGAAGGGGCCCAGCAGTTGGCCGAGAAAGGAAGAGTCATCTCCGGATACTTTCTACATGACTCCGTCTTTGT
GAATCCCATAGTCATTAGGCCAGGTGGCGACAAGACTGTGACGCATCTGCACATGAGGCCCTCGCGTCAGACCCA
GGACCAGTTGTCCCATGCTTATGACTTCCAAATCTACACAGAGGTGGGCGATCGGTGGCAGACAAACTGCCGCGG
GCAAATCTCAATCCAGTATGAGGGTAAATCCACCGGTGCGACCATTGCGGAGCAGCAGCAGCAGCAGCAAGTGAC
AAGGGCGGATACCGTGGCTCTGCAGTTGCAGCAAGAGGAGGCCTTCTACAAAGAGCAGTGGGAAACCGCTCGTCG
AGAGTGCCACATGCACGTGCCTACGAGCAAGATCTACAAGACCTTTCAAGCCAATGGGCTGCACTATGGACCATC
GTTCCAAGTCATGGATGATCTACAGTGGGGGGGATCTAATATCTCGATCGGGACGATCAAGCCCTTCGAGTGGAC
CGCAGAGCAGTCCGAAAATGCTCCAGAGCCGCACATGGTTCATCCCTCTACACTGGACGGTCTGGGTCAGCTAGG
CTGGGTGGCCCTTACGCAGGGAGGCGAGAAACTCGTCACCACAGGTCTAGTGTCGACTCGGGTGCGGGAGGCTTG
GATATCTGGCGCCGGGGCCTCCGCAGAGCACATTGACACCCTGCATGCTGTGGCACACAGCCGGTTCAAGGGTCT
GCGAGGTACGGACACCTCCGTATATGCCGTTGACAGCAGCGGTAACTTGCGGTTGTGGATCTCCGGGATGGAAAC
CACCTCCATGTCTAGTAACAACGCGCTGGTGGGAGAGGCACAACGGAGAGAACTATGCTTCTCGATCGACTGGAA
GCCAGATTTGACTCTAATGAATCGTGAGCAGCTACGGGAATACTGCGGTCAACGCCCTTCTCACGGGGAGACAAA
TGGGGCTGGAGTCCGAGCCACCAATGGGCTCGACTGTGCAGAAGAGACCGATTATCTCCTTATGCAATACGCACG
TCGAGCTGTGGAAAGGTATGCCGACCGCCAAGCTAGATTAAACCTGCCTGTCCATCTGCAACGGTATCTTGAATG
GCTGGAGCGCAAGCTTGCCACTACGACCTGTGATACTATGCAAGACCGCCCTGGGGACCAAGCCCTTGAAGACCG
CGTGTTGAACCAGACCTCGGCGGGGCATTTGTACGTCACTTTCGGAAGATTGCTGGATTCGATTCTTGACGGGGA
TATTGAGGCCGGCTCAATCCTGGATGGCGAACAAGGAACGCCGGAGCATGCTGCTGTGCAGCATCGTCAACTCCT
TTGCGACCAGATCTTGGATAAGGACAAGGCTCTGCACCGTTACATCGATGCGTTGGCCCACAAAACCCCGCAAAT
GAGGATTCTAGAAGTCAACGCCAGCACCGGCTCGCTGGCCCCGCAATTGATAAGTGCTTTAACACACCATGGTGT
AGATGGAACAGAGACGCATCGCTTCTCACTTTACGATTACACTGACAGATCGGACCGATGTCTTCAGGAAGTCCC
AGAGCGCTTAGCCGCACTAGGTCGCAAAGTCGCATACAGAGTACTCGATATCGATCAAGACCCAGTAGCGCAAGG
ATTTGACCTTGCTAGCTATGATGTGGTTGTGTCTGCATGGGTGAGTCTTGACGTCGGGGGCTTCGACTTTTGTCT
AGACAGGGTACTAACGGTCAAATAACCAGGTCTCTGGTCATGTCCAAGGCCTGGCTTCCTTTGTCAGAAACGCTC
GGAAACTACTCAAACCGTGAGTAAACCCGTCCACCATAAAATGAGGGCGATAGTATTGATGGTTCTTTCACAGCG
GCGGCACACTCCTGATCCTAGACATGGTCCGAGGAGGTTCATTGAGATCGGGCTTTGTATTCGGAACCCTACCGG
AATGGTGGGAAGACACATGCTCAGTACAAGGCTGGGACAGTCTGCTCACCTCCAACGGCTTTTCAGGAGTTGAAA
TCTCGTTTCCGCATGATTTGGGGTGCAATGTTATGGCTACAACAGCAACCGGCACTATGGCCATAAACTGCAGTC
CTCCTCTGAAGCGGACTATCCTCGTCATTGATCCTGAATCCCGCTTACAAGCCCAGGTAGCGAGCATATTATCAG
ATACGAGCCTCGGAGTTGGATACGCCATTGATATTTGCTCGCTCAGCGATATGGACACGTTATCGACATCCACGG
ACGGCTCTTTGGTGGTCATGCTCCCTGAGATAGAACAGCCTTTCCTGGTCGGTCTCAATGGAACCACTTATAAAG
CCCTCCACAGCCTCCTCTGTAAAGCCCAAGACGTTGTTTGGATTACTGCTGGAAACGAGGAGTCGCCTCACGCAC
CCCGGCGTCACTTAGTTGATGGCCTGGCGAGAGTGCTGTGCACTGAGAATGATCGACTCTCCTTTATCACCGCAC
ACTTGGAAGACCATGCCGCCAACCCTGCCGTGTGGGCAAAACATATCTATCAGATCATGGGCACGAGACTCGAGC
AACAGGCTACCAAGGCCAGTGAGCTCGATTACCGAGAGCAGGATGGATTGCTGCACATCGGTCGCGTGGCTGAAG
CAGAAGAGTTAAATGATGCTCTGTTTGAACAAACGCAGGCCCCGCCTAAGGTGCGTCCGTTCAAACAGGGCCCTC
CATTGACCTGTACGATCGCGAACCCGGGGTCAGTGGAGAGCAAAGCGATGCTCTTTGTTGAAGACACCGAGGCCA
TCGAGCGCCCACTCGGTGATGATGAAGTGGAAATCGAGGTGAAAGCGGTGGGGGTCAACTTCCGCGATATCTTTG
TCCTGCTGGGCCGGCTCAGTGACGGCGACAGCATCGGTACAGAATGCTCAGGGATTGTGACTCGGGTGGGTGCGG
CAGCAACTTCGGACCTGAAGCCAGGAGACCGGGTCTGTGCCGTCCTCCTCGACTGTTTCCGCACCCTGGTTCGTT
GTCACTACCAATTTGTTTCGAAGATCCCGGATGCCCTGAGTTTTGCCGCGGGCGCAGCGATCCCCCTCGGCGGCG
TGACTGCATATCATTCCCTGGTGCAGATCGCACGGTTACGGAAGGGAGAGACAGTGCTCATTCACTCGGGGGCTG
GGGGTACTGGGCAAATGGCCATCAAAGTTGCCCAAGCCCTGGGGGCCAAGGTCTTTGCCACGGTCGGCTCAGACG
ACAAACGGGACTTGCTTGAGCGGCTGTATGGCATTCCCAAGGAGCATATATTCTACAGTCGAGACACGTCGTTCC
AGCGCCATGTTATGCGATTGACTGGTGGCCGTGGTGTGGATGTCGTGCTGAACTCGCTCTCCGGCGATGGCCTCA
TTGCCTCGTGGGAGTGCGTCGCCCCGTACGGACGGTTCGTGGAACTGGGCAAGTCCGATATTCAATCAAACTCCA
AGCTGCCAATGCGCAACTTCGGGCGCAACGTCTCCTTCTCGGTAGTAGCCATCGACCAGATGCATTATGACCGAC
CGTATATCATCCAGGAATCGCTGGGGCCGGTCGTGGAGATGGTCACGGCTGGCACACTGCAGCCCGCCTGGCCAC
TTCAGGAATTCACCCTCTCATCGGCAGAGGAAGCATTCCGCTTGATGCAAAGCGGCAAAAATGTGGGCAAGTTGG
TGATCAACATGACCCCCACCGACCTCGTACAGGTAAGTTAAACTTCCGTCCTTCAGACCTTTGCAGGCACTAACT
GGTTGAAATTCATTCTAGACGTCCATTCGACATGTCCCCAGATATTCATTCCCCCCCGAGGCAACGTACTTGATT
GCCGGTGGACTCGGGGGCCTAGGGCGAAGCGCCGCTCGATGGATGGCATCCATGGGGGCGAAGAATCTGATTCTG
CTGTCTCGATCGGGTCCCAAGGCAACCGCAGCACAAGAGCTTATTCGGGAACTCACCGATCAGGGAGTTCGCGTC
CGGGCTCCCCGGTGTGACCTGACTTCTTCCGAGGCGTTGACTCGGGCTCTAGAGGAGTGCCGGGACCTGCCTCCG
ATTCGAGGGTGTATCCAAGGAACAATGGTTTTGCAGGACACGATCTTCGAAAGTCTGACCTTCAGTCAGTGGGAT
ACTACTCTCCAGTCCAAGGTGAAAAGTACGGAGAACCTGCACGCGCAGCTCCCTGCCGATCTCGACTTCTTCATT
CTTCTCTCCTCGCTTGCCGGTGTCATTGGCCACATTTCACAAGCCAACTACGCAGCGGGGAATACCTTTCAGGAT
GCATTTGCGGCCTACCGTCGGTCTCTGGGTCAGCGCGCGGTCGCGCTCGATCTGGGATGGATGCGCGAGATTGGA
GTTGCTGCTGAGCAAGAACACTTGGCCATGCGCGTGGATGCGGCCCCCAGTATGGCTGGGATCAGCGAGGCCGAG
TTCCTGGCCCTCCTGGAGCGGTGCTGTGATCCTGCGGCGAATCCAGTCACCACGACCATTAGCAGCAAACCACAG
ATTCTCGTCGGAGTGGTTACACCGGCACAGCTTCGGGCTCATGGCCACGAGATACCAACGTGGCTAACCGAACGC
AGCATGTTCCAAACTCTCCGGCAAGAAGCGACGGGACCAGGGGAGACCGACGGCGCAGATAACAGTCCCATCAAC
CCCGGCGGCGACACCTCACCCAGCAATTGGCACCGGGCATTTGCGAGGGCAGATTCATCCTCAGCCGCGGTCACC
GTGGTGATCGAAGGGTTGACGCGAAAACTTGCACGGTCATTGAGTCTGACTTCGCCATCCGAGATCGACCAGCAG
CGCTCGCTGGCTCTACAAGGGGTGGACTCGTTGCTGGCGGTGGAGATGCGCCAATGGGTCTCGCGGGCGTTTGCG
GCCGAGGTTTCAGCGCTAGATATCACGAGTGCGCCGAATCTGGAGGAGTTGGCGGGAATGGTGGTTGCGTATAGT
GAGGTGAAATTCGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail