Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS83_1|g2566.t1
Gene name
Locationscaffold_016:288399..290063
Strand+
Gene length (bp)1664
Transcript length (bp)1440
Coding sequence length (bp)1440
Protein length (aa) 480

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08288 PIGA PIGA (GPI anchor biosynthesis) 7.5E-47 42 131
PF13439 Glyco_transf_4 Glycosyltransferase Family 4 1.1E-27 17 180
PF00534 Glycos_transf_1 Glycosyl transferases group 1 2.4E-26 201 333
PF13692 Glyco_trans_1_4 Glycosyl transferases group 1 6.4E-24 204 331
PF13579 Glyco_trans_4_4 Glycosyl transferase 4-like domain 1.8E-11 17 178
PF13477 Glyco_trans_4_2 Glycosyl transferase 4-like 2.0E-05 21 154

GO

GO Term Description Terminal node
GO:0016757 glycosyltransferase activity Yes
GO:0006506 GPI anchor biosynthetic process Yes
GO:0008654 phospholipid biosynthetic process No
GO:1903509 liposaccharide metabolic process No
GO:0019538 protein metabolic process No
GO:0009987 cellular process No
GO:1901576 organic substance biosynthetic process No
GO:0009247 glycolipid biosynthetic process No
GO:0046486 glycerolipid metabolic process No
GO:0043412 macromolecule modification No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0008610 lipid biosynthetic process No
GO:0006664 glycolipid metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006629 lipid metabolic process No
GO:0006644 phospholipid metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0006497 protein lipidation No
GO:0019637 organophosphate metabolic process No
GO:0006505 GPI anchor metabolic process No
GO:0006661 phosphatidylinositol biosynthetic process No
GO:0044238 primary metabolic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0016740 transferase activity No
GO:0006650 glycerophospholipid metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0044255 cellular lipid metabolic process No
GO:0046467 membrane lipid biosynthetic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0046474 glycerophospholipid biosynthetic process No
GO:0006793 phosphorus metabolic process No
GO:0036211 protein modification process No
GO:0045017 glycerolipid biosynthetic process No
GO:0003824 catalytic activity No
GO:0006807 nitrogen compound metabolic process No
GO:0046488 phosphatidylinositol metabolic process No
GO:0044237 cellular metabolic process No
GO:0090407 organophosphate biosynthetic process No
GO:0006643 membrane lipid metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 417 439 22

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GT4 3.0E-35 203 336

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID3
Orthogroup2522
Change Orthofinder run
Species Protein ID
Aspergillus niger CBS 112.32 Ani_SJS6_1|g8781.t1
Aspergillus niger CBS 113.50 Ani_SJS3_1|g4299.t1
Aspergillus niger CBS 115988 Ani_SJS16_1|g794.t1
Aspergillus niger CBS 115989 Ani_SJS83_1|g2566.t1 (this protein)
Aspergillus niger CBS 118.52 Ani_SJS14_1|g185.t1
Aspergillus niger CBS 124.48 Ani_SJS7_1|g3561.t1
Aspergillus niger CBS 131.52 Ani_SJS8_1|g1313.t1
Aspergillus niger CBS 133816 Ani_SJS71_1|g1443.t1
Aspergillus niger CBS 147320 Ani_SJS28_1|g2249.t1
Aspergillus niger CBS 147321 Ani_SJS30_1|g5306.t1
Aspergillus niger CBS 147322 Ani_SJS35_1|g320.t1
Aspergillus niger CBS 147323 Ani_SJS38_1|g5994.t1
Aspergillus niger CBS 147324 Ani_SJS39_1|g1362.t1
Aspergillus niger CBS 147343 Ani_SJS115_1|g1855.t1
Aspergillus niger CBS 147344 Ani_SJS70_1|g6801.t1
Aspergillus niger CBS 147345 Ani_SJS72_1|g2264.t1
Aspergillus niger CBS 147346 Ani_SJS75_1|g7316.t1
Aspergillus niger CBS 147347 Ani_SJS76_1|g2186.t1
Aspergillus niger CBS 147352 Ani_SJS95_1|g3449.t1
Aspergillus niger CBS 147353 Ani_SJS100_1|g2264.t1
Aspergillus niger CBS 147371 Ani_SJS27_1|g1287.t1
Aspergillus niger CBS 147482 Ani_SJS55_1|g3031.t1
Aspergillus niger CBS 630.78 Ani_SJS18_1|g6660.t1
Aspergillus niger CBS 769.97 Ani_SJS82_1|g3114.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS83_1|g2566.t1
MTYNIAMVSDFFFPQPGGIESHIYQLSTKLIDRGHKVIIITHAYKGRTGVRYLTNGLKVYHVPFFVIYRESTMPT
VFSFFPIFRNIVIREQIQIVHGHASLSSFCHEAILHARTMGLRTVFTDHSLFGFADAASILTNKLLKFILSDVDH
VICVSHTCKENTVLRASLDPLMVSVIPNAVVAENFRPPEPRPIARLMEPNDIITIVVISRLFYNKGTDLLIAAIP
RILASHPNVRFIIAGSGPKAIDLEQMLERNVLQDKVELLGSVRHEEVRDVMIRGHIYLHPSLTEAFGTVLVEAAS
CGLYVVCTRVGGIPEVLPQHMTTFAKPEEDDIVLATGKAIAALRSNKVRTDRFHDQVKMMYSWTDVAERTERVYQ
GISGDISPEEFYGYYPGQGWEAGRDRVRSFALIDRLKRYYGCGVWAGKLFCLCVVIDFLLYVFLEMWFPRANIDI
ARSWPKKINRKENKRPGSTYKGDRLGPAS*
Coding >Ani_SJS83_1|g2566.t1
ATGACATACAACATTGCTATGGTCAGTGACTTTTTCTTTCCCCAACCAGGCGGGATTGAAAGTCACATCTATCAG
CTATCGACCAAGCTTATCGATCGCGGCCATAAAGTCATCATCATCACCCATGCCTACAAGGGACGCACTGGCGTT
CGCTATCTCACCAATGGGCTCAAAGTTTACCATGTCCCCTTCTTCGTGATCTACCGGGAGTCGACCATGCCGACG
GTCTTCTCATTCTTCCCTATCTTTCGAAACATAGTGATTCGTGAGCAAATTCAAATTGTACATGGCCATGCAAGT
TTGAGCAGCTTTTGTCACGAAGCTATTCTTCATGCCCGGACGATGGGCCTCCGTACGGTTTTCACCGACCATTCG
CTGTTTGGATTCGCAGATGCAGCATCAATTCTTACCAACAAGCTGCTCAAGTTCATTTTGAGCGACGTAGACCAT
GTTATTTGTGTCAGCCATACATGCAAAGAGAACACGGTGCTTCGAGCCTCGCTAGACCCGTTGATGGTCTCTGTT
ATTCCCAATGCGGTGGTTGCAGAGAACTTCCGACCACCAGAACCACGGCCAATCGCGCGACTTATGGAGCCCAAT
GATATTATCACGATCGTTGTCATATCTCGTCTTTTCTACAATAAAGGAACCGATCTCCTTATTGCCGCCATTCCT
CGGATCCTTGCCTCTCATCCGAATGTACGGTTCATCATTGCCGGATCAGGACCCAAGGCCATCGATCTCGAACAG
ATGCTAGAAAGGAATGTATTGCAGGACAAGGTTGAATTGCTTGGTTCGGTGCGACACGAAGAGGTCCGTGACGTG
ATGATCCGGGGCCACATTTATTTACATCCGAGTTTGACTGAAGCGTTTGGTACTGTCCTTGTGGAAGCTGCAAGC
TGTGGTCTCTACGTGGTGTGCACACGCGTCGGTGGCATTCCTGAGGTGCTTCCTCAACACATGACAACTTTTGCG
AAACCGGAGGAGGACGATATCGTGCTCGCCACTGGAAAAGCCATCGCAGCATTACGTTCGAACAAAGTCCGCACG
GATCGGTTCCATGACCAGGTCAAGATGATGTATTCTTGGACGGATGTAGCTGAGCGTACGGAACGTGTATACCAA
GGCATCTCCGGGGACATTAGCCCCGAGGAATTCTACGGCTACTACCCCGGACAGGGATGGGAGGCCGGCCGGGAT
CGGGTGCGAAGCTTTGCCCTCATTGATCGCCTAAAACGATACTATGGATGCGGAGTGTGGGCAGGCAAGCTGTTT
TGCCTCTGCGTGGTGATCGACTTCTTACTTTATGTGTTCTTGGAGATGTGGTTTCCCCGTGCGAATATCGACATT
GCGCGCAGCTGGCCCAAGAAAATTAACCGAAAGGAAAACAAACGGCCGGGGTCTACATATAAAGGCGACCGTCTG
GGACCTGCATCTTGA
Transcript >Ani_SJS83_1|g2566.t1
ATGACATACAACATTGCTATGGTCAGTGACTTTTTCTTTCCCCAACCAGGCGGGATTGAAAGTCACATCTATCAG
CTATCGACCAAGCTTATCGATCGCGGCCATAAAGTCATCATCATCACCCATGCCTACAAGGGACGCACTGGCGTT
CGCTATCTCACCAATGGGCTCAAAGTTTACCATGTCCCCTTCTTCGTGATCTACCGGGAGTCGACCATGCCGACG
GTCTTCTCATTCTTCCCTATCTTTCGAAACATAGTGATTCGTGAGCAAATTCAAATTGTACATGGCCATGCAAGT
TTGAGCAGCTTTTGTCACGAAGCTATTCTTCATGCCCGGACGATGGGCCTCCGTACGGTTTTCACCGACCATTCG
CTGTTTGGATTCGCAGATGCAGCATCAATTCTTACCAACAAGCTGCTCAAGTTCATTTTGAGCGACGTAGACCAT
GTTATTTGTGTCAGCCATACATGCAAAGAGAACACGGTGCTTCGAGCCTCGCTAGACCCGTTGATGGTCTCTGTT
ATTCCCAATGCGGTGGTTGCAGAGAACTTCCGACCACCAGAACCACGGCCAATCGCGCGACTTATGGAGCCCAAT
GATATTATCACGATCGTTGTCATATCTCGTCTTTTCTACAATAAAGGAACCGATCTCCTTATTGCCGCCATTCCT
CGGATCCTTGCCTCTCATCCGAATGTACGGTTCATCATTGCCGGATCAGGACCCAAGGCCATCGATCTCGAACAG
ATGCTAGAAAGGAATGTATTGCAGGACAAGGTTGAATTGCTTGGTTCGGTGCGACACGAAGAGGTCCGTGACGTG
ATGATCCGGGGCCACATTTATTTACATCCGAGTTTGACTGAAGCGTTTGGTACTGTCCTTGTGGAAGCTGCAAGC
TGTGGTCTCTACGTGGTGTGCACACGCGTCGGTGGCATTCCTGAGGTGCTTCCTCAACACATGACAACTTTTGCG
AAACCGGAGGAGGACGATATCGTGCTCGCCACTGGAAAAGCCATCGCAGCATTACGTTCGAACAAAGTCCGCACG
GATCGGTTCCATGACCAGGTCAAGATGATGTATTCTTGGACGGATGTAGCTGAGCGTACGGAACGTGTATACCAA
GGCATCTCCGGGGACATTAGCCCCGAGGAATTCTACGGCTACTACCCCGGACAGGGATGGGAGGCCGGCCGGGAT
CGGGTGCGAAGCTTTGCCCTCATTGATCGCCTAAAACGATACTATGGATGCGGAGTGTGGGCAGGCAAGCTGTTT
TGCCTCTGCGTGGTGATCGACTTCTTACTTTATGTGTTCTTGGAGATGTGGTTTCCCCGTGCGAATATCGACATT
GCGCGCAGCTGGCCCAAGAAAATTAACCGAAAGGAAAACAAACGGCCGGGGTCTACATATAAAGGCGACCGTCTG
GGACCTGCATCTTGA
Gene >Ani_SJS83_1|g2566.t1
ATGACATACAACATTGCGTGAGTGCCTGCTTGCGTTCTGAACAATCAATCAATCAAGGTTGGCCTACTAATCAAC
GGCCCACAGTATGGTCAGTGACTTTTTCTTTCCCCAACCAGGTCAGTCGTTCTGTCTCATTCTCTTGTCTCTCCG
ACGACCAGCTACTGATGGTCCCAGGCGGGATTGAAAGTCACATCTATCAGCTATCGACCGTAAGATTGCTAGACC
TCTCGCTCGAGCCAACGCTTATCGCTCTATAGAAGCTTATCGATCGCGGCCATAAAGTCATCATCATCACCCATG
CCTACAAGGGACGCACTGGCGTTCGCTATCTCACCAATGGGCTCAAAGTTTACCATGTCCCCTTCTTCGTGATCT
ACCGGGAGTCGACCATGCCGACGGTCTTCTCATTCTTCCCTATCTTTCGAAACATAGTGATTCGTGAGCAAATTC
AAATTGTACATGGCCATGCAAGTTTGAGCAGCTTTTGTCACGAAGCTATTCTTCATGCCCGGACGATGGGCCTCC
GTACGGTTTTCACCGACCATTCGCTGTTTGGATTCGCAGATGCAGCATCAATTCTTACCAACAAGCTGCTCAAGT
TCATTTTGAGCGACGTAGACCATGTTATTTGTGTCAGCCATACATGGTACGTCAACTACATGGATTATACTGAAA
GCATACTAACTTTAAGGGCTAGCAAAGAGAACACGGTGCTTCGAGCCTCGCTAGACCCGTTGATGGTCTCTGTTA
TTCCCAATGCGGTGGTTGCAGAGAACTTCCGACCACCAGAACCACGGCCAATCGCGCGACTTATGGAGCCCAATG
ATATTATCACGATCGTTGTCATATCTCGTCTTTTCTACAATAAAGGAACCGATCTCCTTATTGCCGCCATTCCTC
GGATCCTTGCCTCTCATCCGAATGTACGGTTCATCATTGCCGGATCAGGACCCAAGGCCATCGATCTCGAACAGA
TGCTAGAAAGGAATGTATTGCAGGACAAGGTTGAATTGCTTGGTTCGGTGCGACACGAAGAGGTCCGTGACGTGA
TGATCCGGGGCCACATTTATTTACATCCGAGTTTGACTGAAGCGTTTGGTACTGTCCTTGTGGAAGCTGCAAGCT
GTGGTCTCTACGTGGTGTGCACACGCGTCGGTGGCATTCCTGAGGTGCTTCCTCAACACATGACAACTTTTGCGA
AACCGGAGGAGGACGATATCGTGCTCGCCACTGGAAAAGCCATCGCAGCATTACGTTCGAACAAAGTCCGCACGG
ATCGGTTCCATGACCAGGTCAAGATGATGTATTCTTGGACGGATGTAGCTGAGCGTACGGAACGTGTATACCAAG
GCATCTCCGGGGACATTAGCCCCGAGGAATTCTACGGCTACTACCCCGGACAGGGATGGGAGGCCGGCCGGGATC
GGGTGCGAAGCTTTGCCCTCATTGATCGCCTAAAACGATACTATGGATGCGGAGTGTGGGCAGGCAAGCTGTTTT
GCCTCTGCGTGGTGATCGACTTCTTACTTTATGTGTTCTTGGAGATGTGGTTTCCCCGTGCGAATATCGACATTG
CGCGCAGCTGGCCCAAGAAAATTAACCGAAAGGAAAACAAACGGCCGGGGTCTACATATAAAGGCGACCGTCTGG
GACCTGCATCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail