Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS82_1|g10447.t1
Gene name
Locationscaffold_092:86495..87712
Strand+
Gene length (bp)1217
Transcript length (bp)1149
Coding sequence length (bp)1149
Protein length (aa) 383

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00544 Pectate_lyase_4 Pectate lyase 2.2E-10 123 297

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 21 0.999523

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
PL1_4 3.1E-79 116 299

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID3
Orthogroup10573
Change Orthofinder run
Species Protein ID
Aspergillus niger CBS 113.50 Ani_SJS3_1|g4206.t1
Aspergillus niger CBS 118.52 Ani_SJS14_1|g1937.t1
Aspergillus niger CBS 124.48 Ani_SJS7_1|g1634.t1
Aspergillus niger CBS 131.52 Ani_SJS8_1|g10320.t1
Aspergillus niger CBS 133816 Ani_SJS71_1|g6568.t1
Aspergillus niger CBS 147320 Ani_SJS28_1|g4.t1
Aspergillus niger CBS 147321 Ani_SJS30_1|g3458.t1
Aspergillus niger CBS 147322 Ani_SJS35_1|g1446.t1
Aspergillus niger CBS 147323 Ani_SJS38_1|g9431.t1
Aspergillus niger CBS 147324 Ani_SJS39_1|g4843.t1
Aspergillus niger CBS 147343 Ani_SJS115_1|g2223.t1
Aspergillus niger CBS 147344 Ani_SJS70_1|g5488.t1
Aspergillus niger CBS 147345 Ani_SJS72_1|g9484.t1
Aspergillus niger CBS 147346 Ani_SJS75_1|g1595.t1
Aspergillus niger CBS 147347 Ani_SJS76_1|g1118.t1
Aspergillus niger CBS 147352 Ani_SJS95_1|g1759.t1
Aspergillus niger CBS 147353 Ani_SJS100_1|g9711.t1
Aspergillus niger CBS 147371 Ani_SJS27_1|g9633.t1
Aspergillus niger CBS 147482 Ani_SJS55_1|g2341.t1
Aspergillus niger CBS 630.78 Ani_SJS18_1|g7102.t1
Aspergillus niger CBS 769.97 Ani_SJS82_1|g10447.t1 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS82_1|g10447.t1
MRPDLLSTFVTVMAFAHHAEAAQSSIVSGSAPGFAAGVTGGGDATPVYPTTIDELKEYLTSSSPQNIVIEGTFDF
VGSEGTKTYQACNIYDCTPDNGGQAILNTLGGCGDTSTYDVTIDVAGYQGINVASDKTLVGKGTGAVLNGKGLRF
VGVSNIIIQNIEITNLNPKYVWGGDALTFSDTNQIWIDHVTTSSLGRQHYSFGQESDNAITISNSFINGKTDYSA
TCDGHTYWGLELVGSSDQITFYKNYVYYTSGRSPALSGNTLFHAVNSVWADNSGHAIEGTDNGMGLFEGNVFNNV
PTIVQSGFVGQLFSSESANLSQCETSLGRDCVTNAYTSSGSFSYDDDGFFVDFENLPIVSAASASSIASTVPSDA
GNTLSST*
Coding >Ani_SJS82_1|g10447.t1
ATGAGGCCCGATCTTCTATCTACCTTCGTGACCGTGATGGCCTTCGCGCATCATGCCGAAGCAGCGCAGTCTTCT
ATTGTCTCGGGGAGTGCTCCCGGCTTCGCAGCGGGCGTGACGGGAGGAGGCGACGCGACCCCTGTCTATCCGACA
ACTATCGACGAGCTGAAAGAGTACCTCACCTCCTCTTCGCCTCAGAACATTGTTATCGAGGGTACTTTCGACTTT
GTCGGTTCTGAGGGCACCAAAACTTATCAGGCTTGTAACATCTATGACTGCACACCGGATAATGGTGGACAGGCT
ATACTTAACACGCTTGGGGGATGCGGGGACACCTCGACATATGACGTGACCATCGACGTTGCAGGATACCAGGGT
ATCAATGTCGCATCAGACAAAACTCTGGTCGGTAAAGGGACAGGCGCTGTGCTCAATGGCAAGGGCCTGCGGTTC
GTGGGCGTCTCCAACATCATCATTCAGAACATCGAAATCACCAACCTCAACCCGAAGTATGTTTGGGGAGGAGAT
GCTCTTACGTTCTCCGACACTAATCAGATCTGGATCGACCATGTCACCACCTCCTCACTAGGCCGCCAGCACTAT
AGTTTTGGCCAGGAGAGTGACAACGCCATCACCATCTCCAATAGCTTCATCAACGGGAAGACTGACTACTCTGCT
ACTTGTGATGGACACACGTACTGGGGCCTCGAGCTGGTCGGCTCCAGTGACCAAATCACCTTCTACAAAAACTAC
GTCTACTACACCTCCGGGCGCAGTCCCGCTCTCAGTGGCAATACACTCTTCCACGCAGTCAACAGTGTCTGGGCT
GATAACAGCGGTCACGCCATCGAAGGGACTGACAACGGCATGGGCCTTTTTGAGGGGAACGTGTTCAACAATGTC
CCCACCATTGTTCAGAGCGGCTTTGTCGGTCAGCTATTCAGCTCCGAGTCGGCCAATCTTAGCCAATGCGAGACG
TCCTTGGGAAGAGACTGTGTGACCAATGCTTACACCAGCTCTGGTTCCTTCAGTTATGATGACGATGGATTCTTT
GTTGACTTTGAGAACCTGCCCATTGTATCTGCTGCATCTGCATCTTCGATTGCGAGTACTGTTCCTTCGGATGCT
GGTAATACCCTGAGCAGCACCTAA
Transcript >Ani_SJS82_1|g10447.t1
ATGAGGCCCGATCTTCTATCTACCTTCGTGACCGTGATGGCCTTCGCGCATCATGCCGAAGCAGCGCAGTCTTCT
ATTGTCTCGGGGAGTGCTCCCGGCTTCGCAGCGGGCGTGACGGGAGGAGGCGACGCGACCCCTGTCTATCCGACA
ACTATCGACGAGCTGAAAGAGTACCTCACCTCCTCTTCGCCTCAGAACATTGTTATCGAGGGTACTTTCGACTTT
GTCGGTTCTGAGGGCACCAAAACTTATCAGGCTTGTAACATCTATGACTGCACACCGGATAATGGTGGACAGGCT
ATACTTAACACGCTTGGGGGATGCGGGGACACCTCGACATATGACGTGACCATCGACGTTGCAGGATACCAGGGT
ATCAATGTCGCATCAGACAAAACTCTGGTCGGTAAAGGGACAGGCGCTGTGCTCAATGGCAAGGGCCTGCGGTTC
GTGGGCGTCTCCAACATCATCATTCAGAACATCGAAATCACCAACCTCAACCCGAAGTATGTTTGGGGAGGAGAT
GCTCTTACGTTCTCCGACACTAATCAGATCTGGATCGACCATGTCACCACCTCCTCACTAGGCCGCCAGCACTAT
AGTTTTGGCCAGGAGAGTGACAACGCCATCACCATCTCCAATAGCTTCATCAACGGGAAGACTGACTACTCTGCT
ACTTGTGATGGACACACGTACTGGGGCCTCGAGCTGGTCGGCTCCAGTGACCAAATCACCTTCTACAAAAACTAC
GTCTACTACACCTCCGGGCGCAGTCCCGCTCTCAGTGGCAATACACTCTTCCACGCAGTCAACAGTGTCTGGGCT
GATAACAGCGGTCACGCCATCGAAGGGACTGACAACGGCATGGGCCTTTTTGAGGGGAACGTGTTCAACAATGTC
CCCACCATTGTTCAGAGCGGCTTTGTCGGTCAGCTATTCAGCTCCGAGTCGGCCAATCTTAGCCAATGCGAGACG
TCCTTGGGAAGAGACTGTGTGACCAATGCTTACACCAGCTCTGGTTCCTTCAGTTATGATGACGATGGATTCTTT
GTTGACTTTGAGAACCTGCCCATTGTATCTGCTGCATCTGCATCTTCGATTGCGAGTACTGTTCCTTCGGATGCT
GGTAATACCCTGAGCAGCACCTAA
Gene >Ani_SJS82_1|g10447.t1
ATGAGGCCCGATCTTCTATCTACCTTCGTGACCGTGATGGCCTTCGCGCATCATGCCGAAGCAGCGCAGTCTTCT
ATTGTCTCGGGGAGTGCTCCCGGCTTCGCAGCGGGCGTGACGGGAGGAGGCGACGCGACCCCTGTCTATCCGACA
ACTATCGACGAGCTGAAAGAGTACCTCACCTCCTCTTCGCCTCAGAACATTGTTATCGAGGGTACTTTCGACTTT
GTCGGTTCTGAGGGCACCAAAACTTATCAGGCTTGTAACATCTATGACTGCACACCGGATAATGGTGGACAGGCT
ATACTTAACACGCTTGGGGGATGCGGGGACACCTCGACATATGACGTGACCATCGACGTTGCAGGATACCAGGGT
ATCAATGTCGCATCAGACAAAACTCTGGTCGGTAAAGGGACAGGCGCTGTGCTCAATGGCAAGGGCCTGCGGTTC
GTGGGCGTCTCCAACATCATCATTCAGAACATCGAAATCACCAACCTCAACCCGAAGTATGTTTGGGGAGGAGAT
GCTCTTACGTTCTCCGACACTAATCAGATCTGGATCGACCATGTCACCACCTCCTCACTAGGCCGCCAGCACTAT
AGTTTTGGCCAGGAGAGTGACAACGCCATCACCATCTCCAATAGCTTCATCAACGGGAAGACTGACTACTCTGCT
ACTTGTGATGGACACACGTACTGGGGCCTCGAGCTGGTCGGCTCCAGTGACCAAATCACCTTCTACAGTGAGTTT
CAACTGGCTGGGTCCGCATCCTGATAGTTGAACGTGCAGATAAACTAAACGCAAAATTAGAAAACTACGTCTACT
ACACCTCCGGGCGCAGTCCCGCTCTCAGTGGCAATACACTCTTCCACGCAGTCAACAGTGTCTGGGCTGATAACA
GCGGTCACGCCATCGAAGGGACTGACAACGGCATGGGCCTTTTTGAGGGGAACGTGTTCAACAATGTCCCCACCA
TTGTTCAGAGCGGCTTTGTCGGTCAGCTATTCAGCTCCGAGTCGGCCAATCTTAGCCAATGCGAGACGTCCTTGG
GAAGAGACTGTGTGACCAATGCTTACACCAGCTCTGGTTCCTTCAGTTATGATGACGATGGATTCTTTGTTGACT
TTGAGAACCTGCCCATTGTATCTGCTGCATCTGCATCTTCGATTGCGAGTACTGTTCCTTCGGATGCTGGTAATA
CCCTGAGCAGCACCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail