Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS7_1|g7708.t1
Gene name
Locationscaffold_076:83668..85421
Strand+
Gene length (bp)1753
Transcript length (bp)1698
Coding sequence length (bp)1698
Protein length (aa) 566

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 1.8E-22 121 262
PF08031 BBE Berberine and berberine like 3.3E-11 506 545

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0043167 ion binding No
GO:0036094 small molecule binding No
GO:0003824 catalytic activity No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.999653

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
AA7 4.3E-39 124 404

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID3
Orthogroup9188
Change Orthofinder run
Species Protein ID
Aspergillus niger CBS 112.32 Ani_SJS6_1|g9458.t1
Aspergillus niger CBS 113.50 Ani_SJS3_1|g7032.t1
Aspergillus niger CBS 115988 Ani_SJS16_1|g10027.t1
Aspergillus niger CBS 115989 Ani_SJS83_1|g2227.t1
Aspergillus niger CBS 118.52 Ani_SJS14_1|g10485.t1
Aspergillus niger CBS 124.48 Ani_SJS7_1|g7708.t1 (this protein)
Aspergillus niger CBS 131.52 Ani_SJS8_1|g5928.t1
Aspergillus niger CBS 133816 Ani_SJS71_1|g2464.t1
Aspergillus niger CBS 147320 Ani_SJS28_1|g4536.t1
Aspergillus niger CBS 147321 Ani_SJS30_1|g7254.t1
Aspergillus niger CBS 147322 Ani_SJS35_1|g5129.t1
Aspergillus niger CBS 147323 Ani_SJS38_1|g7618.t1
Aspergillus niger CBS 147324 Ani_SJS39_1|g9928.t1
Aspergillus niger CBS 147343 Ani_SJS115_1|g10299.t1
Aspergillus niger CBS 147344 Ani_SJS70_1|g5093.t1
Aspergillus niger CBS 147345 Ani_SJS72_1|g583.t1
Aspergillus niger CBS 147346 Ani_SJS75_1|g2265.t1
Aspergillus niger CBS 147347 Ani_SJS76_1|g3619.t1
Aspergillus niger CBS 147352 Ani_SJS95_1|g4324.t1
Aspergillus niger CBS 147353 Ani_SJS100_1|g9055.t1
Aspergillus niger CBS 147371 Ani_SJS27_1|g3526.t1
Aspergillus niger CBS 147482 Ani_SJS55_1|g1803.t1
Aspergillus niger CBS 630.78 Ani_SJS18_1|g2710.t1
Aspergillus niger CBS 769.97 Ani_SJS82_1|g9163.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS7_1|g7708.t1
MLAPTLWTSLLALTATASASAISSNSSCRCFPGDACWPSQSEWAQFNKTVDGRLIKTIPLGKPCHAPYYNASVCA
SLKEQWTEPELHYTSSSSVMAPWFANGSCDPFHPIDKPCTMGNYIDYAVNVSTPAHISATLRFADTHNIRLVIRN
TAHDYNGKSTGAGGLGVWTHNLKSRTLIGNYTDSHYTGPAVRLGAGVQGFEAYEFADAHGYQIVGGECSSVGIAG
GYSQGGGHSALSSRYGMAADQVLAWEVVTGTGEFVTATRDNEYKDLYWALSGGGGGTYGVVVAMTSKLHTSTPTS
GLSLTFTNSNITQDTFFEAVTLYHALLPSIVDAGVMSVWYFTNTSFYISPLTGPGVPVATLRSLVAPFETGLTKL
GINYTLEAKEFDTYLEEFNTMEAEIAVGKAQYGGWLIPREVVVQNTTALTEAYRQIVSDGATFIGVGLNVNRSIA
GDVDNAVLPAWREALIDTTLTTPWEWDARAEMIVEQDKMTYDYIPLLEALAPNSGAYMNEGNFQQPNWKKAFYGV
NYDRLLQVKNKYDPNGLFYALKAVGSDAWTQLEDGRLCRA*
Coding >Ani_SJS7_1|g7708.t1
ATGTTGGCACCAACCCTCTGGACTAGCTTGCTGGCCCTCACGGCCACAGCCTCGGCTTCTGCCATTAGCAGCAAC
TCCAGCTGCCGCTGCTTCCCTGGAGACGCCTGTTGGCCCTCTCAGAGCGAATGGGCGCAGTTCAATAAAACTGTT
GACGGTCGCCTCATCAAGACCATCCCATTGGGAAAACCATGTCATGCTCCCTACTACAATGCCTCTGTCTGTGCC
TCGCTGAAGGAACAATGGACGGAGCCTGAGCTTCACTACACCTCCAGCAGCTCCGTCATGGCCCCATGGTTCGCC
AATGGCAGCTGTGACCCCTTCCACCCGATCGACAAGCCCTGCACGATGGGCAACTACATCGACTACGCCGTGAAC
GTCTCCACTCCTGCACACATCTCGGCGACCCTCCGCTTTGCCGACACCCACAACATCCGGCTGGTGATCCGCAAC
ACCGCCCACGACTACAATGGCAAGTCTACTGGTGCAGGTGGTCTGGGCGTGTGGACACACAACCTGAAGTCCAGG
ACGCTGATCGGTAACTACACGGACTCGCACTACACTGGCCCTGCTGTGCGGCTTGGCGCAGGTGTGCAGGGCTTC
GAAGCATACGAGTTCGCTGATGCCCACGGCTACCAGATCGTGGGCGGAGAGTGCTCCTCAGTGGGTATTGCCGGT
GGATACTCGCAGGGTGGTGGCCACTCTGCGCTCTCATCGCGCTATGGAATGGCAGCTGACCAAGTCCTCGCATGG
GAGGTTGTCACCGGAACTGGCGAGTTTGTGACTGCTACCCGTGACAATGAGTACAAGGATCTGTACTGGGCACTG
AGCGGTGGTGGTGGTGGCACTTACGGTGTTGTTGTGGCCATGACCTCCAAGCTGCATACCTCCACCCCTACCTCT
GGTCTCAGCTTGACCTTCACCAACTCCAACATCACTCAGGACACTTTCTTTGAGGCTGTCACCCTGTACCACGCC
CTTCTTCCCAGCATTGTGGACGCTGGTGTCATGAGCGTTTGGTACTTCACCAACACCTCCTTCTACATCTCTCCC
CTCACCGGACCGGGTGTCCCCGTTGCCACCCTCCGCTCGTTGGTTGCACCCTTCGAAACCGGTCTCACCAAGCTG
GGCATCAACTACACTCTTGAGGCTAAGGAATTCGACACCTATCTCGAGGAATTCAACACCATGGAGGCCGAGATC
GCCGTCGGCAAGGCCCAGTACGGCGGATGGCTGATCCCCCGCGAAGTGGTGGTGCAAAACACCACGGCCTTGACT
GAGGCGTACCGCCAGATTGTCTCTGACGGAGCCACCTTCATCGGAGTCGGCTTGAACGTCAACCGTTCTATTGCA
GGCGACGTCGACAACGCTGTCCTGCCTGCCTGGCGTGAGGCCCTCATCGATACCACTTTGACTACTCCCTGGGAG
TGGGATGCCCGCGCTGAGATGATTGTGGAGCAGGACAAGATGACCTACGACTACATTCCCCTGCTGGAGGCTCTT
GCTCCTAACTCTGGTGCTTATATGAACGAGGGCAACTTCCAGCAGCCTAACTGGAAGAAGGCTTTCTATGGCGTC
AACTATGACCGCTTGTTGCAGGTTAAGAATAAGTACGATCCCAACGGACTGTTCTATGCTCTCAAGGCGGTCGGA
TCGGACGCTTGGACGCAGTTGGAGGATGGACGGTTGTGCCGTGCTTAA
Transcript >Ani_SJS7_1|g7708.t1
ATGTTGGCACCAACCCTCTGGACTAGCTTGCTGGCCCTCACGGCCACAGCCTCGGCTTCTGCCATTAGCAGCAAC
TCCAGCTGCCGCTGCTTCCCTGGAGACGCCTGTTGGCCCTCTCAGAGCGAATGGGCGCAGTTCAATAAAACTGTT
GACGGTCGCCTCATCAAGACCATCCCATTGGGAAAACCATGTCATGCTCCCTACTACAATGCCTCTGTCTGTGCC
TCGCTGAAGGAACAATGGACGGAGCCTGAGCTTCACTACACCTCCAGCAGCTCCGTCATGGCCCCATGGTTCGCC
AATGGCAGCTGTGACCCCTTCCACCCGATCGACAAGCCCTGCACGATGGGCAACTACATCGACTACGCCGTGAAC
GTCTCCACTCCTGCACACATCTCGGCGACCCTCCGCTTTGCCGACACCCACAACATCCGGCTGGTGATCCGCAAC
ACCGCCCACGACTACAATGGCAAGTCTACTGGTGCAGGTGGTCTGGGCGTGTGGACACACAACCTGAAGTCCAGG
ACGCTGATCGGTAACTACACGGACTCGCACTACACTGGCCCTGCTGTGCGGCTTGGCGCAGGTGTGCAGGGCTTC
GAAGCATACGAGTTCGCTGATGCCCACGGCTACCAGATCGTGGGCGGAGAGTGCTCCTCAGTGGGTATTGCCGGT
GGATACTCGCAGGGTGGTGGCCACTCTGCGCTCTCATCGCGCTATGGAATGGCAGCTGACCAAGTCCTCGCATGG
GAGGTTGTCACCGGAACTGGCGAGTTTGTGACTGCTACCCGTGACAATGAGTACAAGGATCTGTACTGGGCACTG
AGCGGTGGTGGTGGTGGCACTTACGGTGTTGTTGTGGCCATGACCTCCAAGCTGCATACCTCCACCCCTACCTCT
GGTCTCAGCTTGACCTTCACCAACTCCAACATCACTCAGGACACTTTCTTTGAGGCTGTCACCCTGTACCACGCC
CTTCTTCCCAGCATTGTGGACGCTGGTGTCATGAGCGTTTGGTACTTCACCAACACCTCCTTCTACATCTCTCCC
CTCACCGGACCGGGTGTCCCCGTTGCCACCCTCCGCTCGTTGGTTGCACCCTTCGAAACCGGTCTCACCAAGCTG
GGCATCAACTACACTCTTGAGGCTAAGGAATTCGACACCTATCTCGAGGAATTCAACACCATGGAGGCCGAGATC
GCCGTCGGCAAGGCCCAGTACGGCGGATGGCTGATCCCCCGCGAAGTGGTGGTGCAAAACACCACGGCCTTGACT
GAGGCGTACCGCCAGATTGTCTCTGACGGAGCCACCTTCATCGGAGTCGGCTTGAACGTCAACCGTTCTATTGCA
GGCGACGTCGACAACGCTGTCCTGCCTGCCTGGCGTGAGGCCCTCATCGATACCACTTTGACTACTCCCTGGGAG
TGGGATGCCCGCGCTGAGATGATTGTGGAGCAGGACAAGATGACCTACGACTACATTCCCCTGCTGGAGGCTCTT
GCTCCTAACTCTGGTGCTTATATGAACGAGGGCAACTTCCAGCAGCCTAACTGGAAGAAGGCTTTCTATGGCGTC
AACTATGACCGCTTGTTGCAGGTTAAGAATAAGTACGATCCCAACGGACTGTTCTATGCTCTCAAGGCGGTCGGA
TCGGACGCTTGGACGCAGTTGGAGGATGGACGGTTGTGCCGTGCTTAA
Gene >Ani_SJS7_1|g7708.t1
ATGTTGGCACCAACCCTCTGGACTAGCTTGCTGGCCCTCACGGCCACAGCCTCGGCTTCTGCCATTAGCAGCAAC
TCCAGCTGCCGCTGCTTCCCTGGAGACGCCTGTTGGCCCTCTCAGAGCGAATGGGCGCAGTTCAATAAAACTGTT
GACGGTCGCCTCATCAAGACCATCCCATTGGGAAAACCATGTCATGCTCCCTACTACAATGCCTCTGTCTGTGCC
TCGCTGAAGGAACAATGGACGGAGCCTGAGCTTCAGTAAGTTGCTCATCTCAATGCCTACATCTCCTTTGCTAAT
AGCTTCCTCTACTAGCTACACCTCCAGCAGCTCCGTCATGGCCCCATGGTTCGCCAATGGCAGCTGTGACCCCTT
CCACCCGATCGACAAGCCCTGCACGATGGGCAACTACATCGACTACGCCGTGAACGTCTCCACTCCTGCACACAT
CTCGGCGACCCTCCGCTTTGCCGACACCCACAACATCCGGCTGGTGATCCGCAACACCGCCCACGACTACAATGG
CAAGTCTACTGGTGCAGGTGGTCTGGGCGTGTGGACACACAACCTGAAGTCCAGGACGCTGATCGGTAACTACAC
GGACTCGCACTACACTGGCCCTGCTGTGCGGCTTGGCGCAGGTGTGCAGGGCTTCGAAGCATACGAGTTCGCTGA
TGCCCACGGCTACCAGATCGTGGGCGGAGAGTGCTCCTCAGTGGGTATTGCCGGTGGATACTCGCAGGGTGGTGG
CCACTCTGCGCTCTCATCGCGCTATGGAATGGCAGCTGACCAAGTCCTCGCATGGGAGGTTGTCACCGGAACTGG
CGAGTTTGTGACTGCTACCCGTGACAATGAGTACAAGGATCTGTACTGGGCACTGAGCGGTGGTGGTGGTGGCAC
TTACGGTGTTGTTGTGGCCATGACCTCCAAGCTGCATACCTCCACCCCTACCTCTGGTCTCAGCTTGACCTTCAC
CAACTCCAACATCACTCAGGACACTTTCTTTGAGGCTGTCACCCTGTACCACGCCCTTCTTCCCAGCATTGTGGA
CGCTGGTGTCATGAGCGTTTGGTACTTCACCAACACCTCCTTCTACATCTCTCCCCTCACCGGACCGGGTGTCCC
CGTTGCCACCCTCCGCTCGTTGGTTGCACCCTTCGAAACCGGTCTCACCAAGCTGGGCATCAACTACACTCTTGA
GGCTAAGGAATTCGACACCTATCTCGAGGAATTCAACACCATGGAGGCCGAGATCGCCGTCGGCAAGGCCCAGTA
CGGCGGATGGCTGATCCCCCGCGAAGTGGTGGTGCAAAACACCACGGCCTTGACTGAGGCGTACCGCCAGATTGT
CTCTGACGGAGCCACCTTCATCGGAGTCGGCTTGAACGTCAACCGTTCTATTGCAGGCGACGTCGACAACGCTGT
CCTGCCTGCCTGGCGTGAGGCCCTCATCGATACCACTTTGACTACTCCCTGGGAGTGGGATGCCCGCGCTGAGAT
GATTGTGGAGCAGGACAAGATGACCTACGACTACATTCCCCTGCTGGAGGCTCTTGCTCCTAACTCTGGTGCTTA
TATGAACGAGGGCAACTTCCAGCAGCCTAACTGGAAGAAGGCTTTCTATGGCGTCAACTATGACCGCTTGTTGCA
GGTTAAGAATAAGTACGATCCCAACGGACTGTTCTATGCTCTCAAGGCGGTCGGATCGGACGCTTGGACGCAGTT
GGAGGATGGACGGTTGTGCCGTGCTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail