Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS75_1|g9618.t1
Gene name
Locationscaffold_107:76840..80155
Strand+
Gene length (bp)3315
Transcript length (bp)2220
Coding sequence length (bp)2220
Protein length (aa) 740

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00544 Pectate_lyase_4 Pectate lyase 3.9E-15 123 295
PF01048 PNP_UDP_1 Phosphorylase superfamily 2.1E-08 378 667

GO

GO Term Description Terminal node
GO:0009116 nucleoside metabolic process Yes
GO:0003824 catalytic activity Yes
GO:0034641 cellular nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044237 cellular metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:1901657 glycosyl compound metabolic process No
GO:0009987 cellular process No
GO:0006807 nitrogen compound metabolic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0046483 heterocycle metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0008152 metabolic process No
GO:0044281 small molecule metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0008150 biological_process No
GO:0044238 primary metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.99967

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
PL1_4 2.3E-91 112 297

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID3
Orthogroup9923
Change Orthofinder run
Species Protein ID
Aspergillus niger CBS 112.32 Ani_SJS6_1|g1069.t1
Aspergillus niger CBS 113.50 Ani_SJS3_1|g9039.t1
Aspergillus niger CBS 115988 Ani_SJS16_1|g8773.t1
Aspergillus niger CBS 115989 Ani_SJS83_1|g8862.t1
Aspergillus niger CBS 118.52 Ani_SJS14_1|g5910.t1
Aspergillus niger CBS 124.48 Ani_SJS7_1|g9430.t1
Aspergillus niger CBS 131.52 Ani_SJS8_1|g9447.t1
Aspergillus niger CBS 133816 Ani_SJS71_1|g9510.t1
Aspergillus niger CBS 147320 Ani_SJS28_1|g9568.t1
Aspergillus niger CBS 147321 Ani_SJS30_1|g6341.t1
Aspergillus niger CBS 147322 Ani_SJS35_1|g7355.t1
Aspergillus niger CBS 147323 Ani_SJS38_1|g8527.t1
Aspergillus niger CBS 147324 Ani_SJS39_1|g844.t1
Aspergillus niger CBS 147343 Ani_SJS115_1|g10567.t1
Aspergillus niger CBS 147344 Ani_SJS70_1|g6168.t1
Aspergillus niger CBS 147345 Ani_SJS72_1|g9051.t1
Aspergillus niger CBS 147346 Ani_SJS75_1|g9618.t1 (this protein)
Aspergillus niger CBS 147347 Ani_SJS76_1|g8986.t1
Aspergillus niger CBS 147352 Ani_SJS95_1|g9160.t1
Aspergillus niger CBS 147353 Ani_SJS100_1|g9866.t1
Aspergillus niger CBS 147371 Ani_SJS27_1|g10873.t1
Aspergillus niger CBS 147482 Ani_SJS55_1|g9490.t1
Aspergillus niger CBS 630.78 Ani_SJS18_1|g10959.t1
Aspergillus niger CBS 769.97 Ani_SJS82_1|g9584.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS75_1|g9618.t1
MKYAAALTAIAALAARAAAVGVSGTPVGFASSATGGGDATPVYPTTTDELVSYLGDDEARVIVLSKTFDFTDTEG
TTTTTGCAPWGTASGCQLAINKDDWCTNYEPDAPTTTVTYNTAGELGITVNSNKSLIGEGTSGVIKGRGLRMVSG
VSNIIIQNIAVTDINPEYVWGGDAITLDEADLVWIDHVTTARIGRQHYVLGTDADSRVSITNNYINGESDYSATC
DGHHYWNVYLDGSSDKVTFSGNYLYKTSGRAPKVQDNTYLHIYNNYWDNNSGHAFEIGSGGYVLAEGNYFSNVDT
VLETDTFEGALFSSDSASSTCESYIGRSCVANVNGGDLTGTSTTVLSNLSGDTLPSADAASTSPASNAGQGNLQF
YNIAFICPTGIELAAVEGMLDELHPALPSTIDKNRYTYGRMGVHYVVVAVLPETGNDRAASVATQLNNDFRSLRF
GLLIGTGGGIPDLAKGRDIRLGDVVVSKPTEIFGGVVQLDRGKSHAHGRFERTGIQQKPLDILLSTAQRLDALHA
RLDTHIPVFMEEMLERYPKMKKRNYVHHGGEKDQLFRTEYEHAGGKDCGHCDPIQAIKRVPRDDSPPAIHYGTIG
SSKTLLRDSVRREILKADFDILCVETEAATLMNEIPCLVVCGISDYADSHSNTTWQPYAAATAAAYAKELLSLIP
PLSKPSKDNIEVAPFASKQQAPTIPTPRIKYLIHDPVAGDLVAGRNLFSSGIYPDGKMERCIYD*
Coding >Ani_SJS75_1|g9618.t1
ATGAAGTACGCTGCTGCTCTCACGGCTATTGCCGCCCTCGCTGCCCGCGCCGCTGCTGTCGGTGTCTCCGGCACT
CCCGTGGGTTTCGCCTCCTCCGCCACTGGTGGTGGTGATGCTACCCCCGTCTACCCTACCACCACCGATGAGCTG
GTCTCTTACCTCGGTGATGACGAGGCCCGTGTCATTGTCCTGTCCAAGACTTTCGACTTCACTGACACTGAGGGC
ACTACCACGACCACCGGTTGCGCTCCCTGGGGTACTGCCTCCGGCTGCCAGCTGGCCATCAACAAGGACGACTGG
TGCACCAACTACGAGCCCGATGCTCCCACCACCACCGTCACCTACAACACTGCTGGTGAACTCGGTATCACCGTC
AACTCCAACAAGTCCTTGATCGGTGAGGGTACCAGCGGTGTCATCAAGGGCCGTGGTCTCCGCATGGTCAGCGGT
GTCTCCAACATCATCATCCAGAACATTGCTGTCACCGACATCAACCCCGAGTACGTCTGGGGTGGTGACGCCATC
ACCCTCGACGAGGCTGACTTGGTCTGGATTGACCACGTTACCACTGCCCGCATTGGTCGCCAGCACTACGTCCTC
GGTACCGACGCTGACAGCCGTGTCTCCATCACCAACAACTACATCAACGGCGAGTCTGACTACTCTGCTACTTGC
GACGGCCACCACTACTGGAACGTGTACCTTGACGGCTCTAGCGACAAGGTCACCTTCAGTGGCAACTACCTGTAC
AAGACCTCCGGCCGTGCCCCCAAGGTCCAGGACAACACCTACCTCCACATCTACAACAACTACTGGGACAACAAC
TCGGGCCACGCTTTCGAGATCGGCTCCGGTGGCTACGTCCTCGCCGAGGGTAACTACTTCTCCAACGTCGACACC
GTCCTCGAGACCGACACCTTCGAGGGTGCTCTCTTCTCCTCTGACAGCGCCTCCTCCACCTGCGAGTCCTACATT
GGCCGTTCCTGCGTTGCCAACGTCAACGGCGGTGACCTCACCGGCACCTCCACCACCGTCCTCTCCAACCTCAGC
GGCGACACCCTCCCCTCTGCTGATGCTGCCAGCACCAGCCCCGCCTCCAACGCTGGTCAGGGTAACCTGCAATTT
TATAACATCGCGTTCATCTGCCCAACGGGCATCGAGCTCGCCGCCGTCGAGGGAATGCTGGATGAACTGCACCCA
GCCCTCCCTTCCACCATTGACAAGAACAGATATACTTATGGCCGCATGGGAGTACACTATGTAGTAGTGGCAGTA
TTGCCCGAAACAGGCAACGACCGGGCCGCATCTGTCGCGACACAACTTAACAACGACTTCAGATCTCTCCGATTC
GGTTTACTGATCGGGACTGGTGGGGGCATACCAGACCTTGCAAAAGGTCGAGATATTCGGCTTGGGGATGTGGTG
GTCAGCAAGCCGACTGAAATATTTGGAGGCGTAGTACAACTTGATCGCGGGAAATCTCATGCTCATGGTCGATTC
GAGCGAACGGGGATACAGCAGAAGCCACTGGATATTCTCCTGTCTACGGCGCAAAGGTTAGACGCTCTTCATGCG
CGCCTTGATACTCATATTCCCGTCTTCATGGAGGAAATGCTCGAGAGATATCCAAAGATGAAGAAGCGAAATTAT
GTTCATCATGGAGGCGAAAAAGACCAACTGTTTCGGACGGAGTATGAGCACGCGGGTGGAAAAGACTGTGGGCAC
TGCGACCCGATCCAGGCTATTAAGCGTGTGCCACGAGATGATTCGCCGCCAGCCATTCACTATGGAACTATCGGG
TCTTCTAAGACCCTTCTCAGAGACAGTGTGAGAAGGGAGATTCTGAAAGCCGACTTCGATATTCTGTGCGTTGAG
ACGGAAGCAGCGACGTTGATGAACGAGATCCCTTGTCTGGTTGTCTGTGGCATCAGTGACTATGCAGATTCACAT
AGTAACACGACATGGCAGCCATATGCTGCTGCTACGGCTGCTGCATATGCGAAGGAGCTGCTTTCGCTGATTCCT
CCTCTGAGCAAGCCTTCAAAAGACAACATCGAAGTGGCTCCGTTTGCATCGAAACAGCAAGCTCCCACTATTCCA
ACACCTAGAATTAAATACTTGATTCATGATCCGGTCGCTGGTGATTTAGTAGCTGGAAGGAACTTGTTCAGCAGT
GGAATCTATCCTGATGGCAAGATGGAAAGGTGCATATATGATTAG
Transcript >Ani_SJS75_1|g9618.t1
ATGAAGTACGCTGCTGCTCTCACGGCTATTGCCGCCCTCGCTGCCCGCGCCGCTGCTGTCGGTGTCTCCGGCACT
CCCGTGGGTTTCGCCTCCTCCGCCACTGGTGGTGGTGATGCTACCCCCGTCTACCCTACCACCACCGATGAGCTG
GTCTCTTACCTCGGTGATGACGAGGCCCGTGTCATTGTCCTGTCCAAGACTTTCGACTTCACTGACACTGAGGGC
ACTACCACGACCACCGGTTGCGCTCCCTGGGGTACTGCCTCCGGCTGCCAGCTGGCCATCAACAAGGACGACTGG
TGCACCAACTACGAGCCCGATGCTCCCACCACCACCGTCACCTACAACACTGCTGGTGAACTCGGTATCACCGTC
AACTCCAACAAGTCCTTGATCGGTGAGGGTACCAGCGGTGTCATCAAGGGCCGTGGTCTCCGCATGGTCAGCGGT
GTCTCCAACATCATCATCCAGAACATTGCTGTCACCGACATCAACCCCGAGTACGTCTGGGGTGGTGACGCCATC
ACCCTCGACGAGGCTGACTTGGTCTGGATTGACCACGTTACCACTGCCCGCATTGGTCGCCAGCACTACGTCCTC
GGTACCGACGCTGACAGCCGTGTCTCCATCACCAACAACTACATCAACGGCGAGTCTGACTACTCTGCTACTTGC
GACGGCCACCACTACTGGAACGTGTACCTTGACGGCTCTAGCGACAAGGTCACCTTCAGTGGCAACTACCTGTAC
AAGACCTCCGGCCGTGCCCCCAAGGTCCAGGACAACACCTACCTCCACATCTACAACAACTACTGGGACAACAAC
TCGGGCCACGCTTTCGAGATCGGCTCCGGTGGCTACGTCCTCGCCGAGGGTAACTACTTCTCCAACGTCGACACC
GTCCTCGAGACCGACACCTTCGAGGGTGCTCTCTTCTCCTCTGACAGCGCCTCCTCCACCTGCGAGTCCTACATT
GGCCGTTCCTGCGTTGCCAACGTCAACGGCGGTGACCTCACCGGCACCTCCACCACCGTCCTCTCCAACCTCAGC
GGCGACACCCTCCCCTCTGCTGATGCTGCCAGCACCAGCCCCGCCTCCAACGCTGGTCAGGGTAACCTGCAATTT
TATAACATCGCGTTCATCTGCCCAACGGGCATCGAGCTCGCCGCCGTCGAGGGAATGCTGGATGAACTGCACCCA
GCCCTCCCTTCCACCATTGACAAGAACAGATATACTTATGGCCGCATGGGAGTACACTATGTAGTAGTGGCAGTA
TTGCCCGAAACAGGCAACGACCGGGCCGCATCTGTCGCGACACAACTTAACAACGACTTCAGATCTCTCCGATTC
GGTTTACTGATCGGGACTGGTGGGGGCATACCAGACCTTGCAAAAGGTCGAGATATTCGGCTTGGGGATGTGGTG
GTCAGCAAGCCGACTGAAATATTTGGAGGCGTAGTACAACTTGATCGCGGGAAATCTCATGCTCATGGTCGATTC
GAGCGAACGGGGATACAGCAGAAGCCACTGGATATTCTCCTGTCTACGGCGCAAAGGTTAGACGCTCTTCATGCG
CGCCTTGATACTCATATTCCCGTCTTCATGGAGGAAATGCTCGAGAGATATCCAAAGATGAAGAAGCGAAATTAT
GTTCATCATGGAGGCGAAAAAGACCAACTGTTTCGGACGGAGTATGAGCACGCGGGTGGAAAAGACTGTGGGCAC
TGCGACCCGATCCAGGCTATTAAGCGTGTGCCACGAGATGATTCGCCGCCAGCCATTCACTATGGAACTATCGGG
TCTTCTAAGACCCTTCTCAGAGACAGTGTGAGAAGGGAGATTCTGAAAGCCGACTTCGATATTCTGTGCGTTGAG
ACGGAAGCAGCGACGTTGATGAACGAGATCCCTTGTCTGGTTGTCTGTGGCATCAGTGACTATGCAGATTCACAT
AGTAACACGACATGGCAGCCATATGCTGCTGCTACGGCTGCTGCATATGCGAAGGAGCTGCTTTCGCTGATTCCT
CCTCTGAGCAAGCCTTCAAAAGACAACATCGAAGTGGCTCCGTTTGCATCGAAACAGCAAGCTCCCACTATTCCA
ACACCTAGAATTAAATACTTGATTCATGATCCGGTCGCTGGTGATTTAGTAGCTGGAAGGAACTTGTTCAGCAGT
GGAATCTATCCTGATGGCAAGATGGAAAGGTGCATATATGATTAG
Gene >Ani_SJS75_1|g9618.t1
ATGAAGTACGCTGCTGCTCTCACGGCTATTGCCGCCCTCGCTGCCCGCGCCGCTGCTGTCGGTGTCTCCGGCACT
CCCGTGGGTTTCGCCTCCTCCGCCACTGGTGGTGGTGATGCTACCCCCGTCTACCCTACCACCACCGATGAGCTG
GTCTCTTACCTCGGTGATGACGAGGCCCGTGTCATTGTCCTGTCCAAGACGTGAGTTTTGAATCCAAAGCAGAGA
ACGAATCGATTCCCGGCTGACCAGTGTCCGAATTTGCCAGTTTCGACTTCACTGACACTGAGGGCACTACCACGA
CCACCGGTTGCGCTCCCTGGGGTACTGCCTCCGGCTGCCAGCTGGCCATCAACAAGGACGACTGGTGCACCAACT
ACGAGCCCGATGCTCCCACCACCACCGTCACCTAGTAAGTTGCCTTCTGAGGTAACCTCGAGTATAAGGGAAGAG
AAAATGCTGACAAGAGGATAGCAACACTGCTGGTGAACTCGGTATCACCGTCAACTCCAACAAGTCCTTGATCGG
TGAGGGTACCAGCGGTGTCATCAAGGGCCGTGGTCTCCGCATGGTCAGCGGTGTCTCCAACATCATCATCCAGTA
TGCATCGTCCAGGACTACATACATTACTCCCATCGCAAACTAACCATGGAATTCCCACAGGAACATTGCTGTCAC
CGACATCAACCCCGAGTACGTCTGGGGTGGTGACGCCATCACCCTCGACGAGGCTGACTTGGTCTGGATTGACCA
CGTTACCGTAAGTCGCCATCCAGCATCATGATTTCCATCCTTTCACCACTAACGAATGCTTCAGACTGCCCGCAT
TGGTCGCCAGCACTACGTCCTCGGTACCGACGCTGACAGCCGTGTCTCCATCACCAACAACTACATCAACGGCGA
GTCTGACTACTCTGCTACTTGCGACGGCCACCACTACTGGAACGTGTACCTTGACGGCTCTAGCGACAAGGTCAC
CTTCAGTGGCAACTACCTGTACAAGACCTCCGGCCGTGCCCCCAAGGTCCAGGACAACACCTACCTCCACATCTA
CAACAACTACTGGGACAACAACTCGGGCCACGCTTTCGAGATCGGCTCCGGTGGCTACGTCCTCGCCGAGGGTAA
CTACTTCTCCAACGTCGACACCGTCCTCGAGACCGACACCTTCGAGGGTGCTCTCTTCTCCTCTGACAGCGCCTC
CTCCACCTGCGAGTCCTACATTGGCCGTTCCTGCGTTGCCAACGTCAACGGCGGTGACCTCACCGGCACCTCCAC
CACCGTCCTCTCCAACCTCAGCGGCGACACCCTCCCCTCTGCTGATGCTGCCAGCACCAGCCCCGCCTCCAACGC
TGGTCAGGGTAACCTGTAAGCGGTATCGCTCCGTCGGGCTCTTACTGCAGATCGCTTTGGTGATGTTGTCGAGTT
TGATGATTCAGACAAGACGAGTTGAGTTTTCTGCTGTTGTACAGCGGAAAAGTGTGTTCGCTTAGATTCTATCTT
AGCCTAATCAATAATTCTAAGATGGACTTGATCCATAGTAATTCTCCATTCAATTGTGATTTAGTAAATTTGATT
TTCTTTGCCTAGTCGCGCTTCTAAACTAGGATCACAGCTGCTCTTAGATCCTCGATGCCCAAGGCCACTAACGCT
TTCTGCCTCAGGACTCCACAGTCCGAGACGGATGTACTGCCTGAGGCCTAAGTGTGCTTCTGCCCAAGGCAACAA
TGGGCATGATCATACATTCACTATACTTGTGCTCTAAGGAATAGTAGGATCGGATGTGAACCATTATATTTAACT
GAGTGGTCTGTGGTCTTTTCATATTTGCAATGACTTGCTTAACTTATTTGGCCGTTCTTCCATAGATGCGATTAT
GTTCGGTAGACTTCAAAAACATGTGATTGCTGACATATTCTGCCTATTTCTGCTGCAAGGCGTATGAAAAATGGC
ATTCCTGTCGTGGCTAATGGCCAAATGCTATGGCATCACAATACTTTTTCTGCTGGCTATCACATTGCATCGAGC
TAGCGTGGATGTTTGGCGCTATAGCAAGGCCAGGCCACACAGCCTCGTGAGGGGTAAATAGGTGATGAGCTTCAA
GGGCGCTAAAACGCCGAAATAGTCAATCCAGATTCGAAACACCATATGCCTTTCTGAATAGGCAATTGTATGCCG
CGTCTCTACATCATGAGTCCACTACCCAATCTTACTCATGACAGTTATAACATCGCGTTCATCTGCCCAACGGGC
ATCGAGCTCGCCGCCGTCGAGGGAATGCTGGATGAACTGCACCCAGCCCTCCCTTCCACCATTGACAAGAACAGA
TATACTTATGGCCGCATGGGAGTACACTATGTAGTAGTGGCAGTATTGCCCGAAACAGGCAACGACCGGGCCGCA
TCTGTCGCGACACAACTTAACAACGACTTCAGATCTCTCCGATTCGGTTTACTGATCGGGACTGGTGGGGGCATA
CCAGACCTTGCAAAAGGTCGAGATATTCGGCTTGGGGATGTGGTGGTCAGCAAGCCGACTGAAATATTTGGAGGC
GTAGTACAACTTGATCGCGGGAAATCTCATGCTCATGGTCGATTCGAGCGAACGGGGATACAGCAGAAGCCACTG
GATATTCTCCTGTCTACGGCGCAAAGGTTAGACGCTCTTCATGCGCGCCTTGATACTCATATTCCCGTCTTCATG
GAGGAAATGCTCGAGAGATATCCAAAGATGAAGAAGCGAAATTATGTTCATCATGGAGGCGAAAAAGACCAACTG
TTTCGGACGGAGTATGAGCACGCGGGTGGAAAAGACTGTGGGCACTGCGACCCGATCCAGGCTATTAAGCGTGTG
CCACGAGATGATTCGCCGCCAGCCATTCACTATGGAACTATCGGGTCTTCTAAGACCCTTCTCAGAGACAGTGTG
AGAAGGGAGATTCTGAAAGCCGACTTCGATATTCTGTGCGTTGAGACGGAAGCAGCGACGTTGATGAACGAGATC
CCTTGTCTGGTTGTCTGTGGCATCAGTGACTATGCAGATTCACATAGTAACACGACATGGCAGCCATATGCTGCT
GCTACGGCTGCTGCATATGCGAAGGAGCTGCTTTCGCTGATTCCTCCTCTGAGCAAGCCTTCAAAAGACAACATC
GAAGTGGCTCCGTTTGCATCGAAACAGCAAGCTCCCACTATTCCAACACCTAGAATTAAATACTTGATTCATGAT
CCGGTCGCTGGTGATTTAGTAGCTGGAAGGAACTTGTTCAGCAGTGGAATCTATCCTGATGGCAAGATGGAAAGG
TGCATATATGATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail