Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS75_1|g3212.t1
Gene name
Locationscaffold_017:164600..167103
Strand-
Gene length (bp)2503
Transcript length (bp)2046
Coding sequence length (bp)2046
Protein length (aa) 682

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00172 Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster domain 1.3E-04 77 107

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Yes
GO:0065007 biological regulation No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0043167 ion binding No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0050794 regulation of cellular process No
GO:0005488 binding No
GO:0010468 regulation of gene expression No
GO:0046914 transition metal ion binding No
GO:0060255 regulation of macromolecule metabolic process No
GO:0009889 regulation of biosynthetic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0003700 DNA-binding transcription factor activity No
GO:0019222 regulation of metabolic process No
GO:0051252 regulation of RNA metabolic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0140110 transcription regulator activity No
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0031323 regulation of cellular metabolic process No
GO:0008150 biological_process No
GO:2001141 regulation of RNA biosynthetic process No
GO:0050789 regulation of biological process No
GO:0080090 regulation of primary metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 551 573 22

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID3
Orthogroup2144
Change Orthofinder run
Species Protein ID
Aspergillus niger CBS 112.32 Ani_SJS6_1|g10611.t1
Aspergillus niger CBS 113.50 Ani_SJS3_1|g10907.t1
Aspergillus niger CBS 115988 Ani_SJS16_1|g10622.t1
Aspergillus niger CBS 115989 Ani_SJS83_1|g1000.t1
Aspergillus niger CBS 118.52 Ani_SJS14_1|g2733.t1
Aspergillus niger CBS 124.48 Ani_SJS7_1|g5303.t1
Aspergillus niger CBS 131.52 Ani_SJS8_1|g6139.t1
Aspergillus niger CBS 133816 Ani_SJS71_1|g8995.t1
Aspergillus niger CBS 147320 Ani_SJS28_1|g5897.t1
Aspergillus niger CBS 147321 Ani_SJS30_1|g10819.t1
Aspergillus niger CBS 147322 Ani_SJS35_1|g11033.t1
Aspergillus niger CBS 147323 Ani_SJS38_1|g10747.t1
Aspergillus niger CBS 147324 Ani_SJS39_1|g5932.t1
Aspergillus niger CBS 147343 Ani_SJS115_1|g9490.t1
Aspergillus niger CBS 147344 Ani_SJS70_1|g2357.t1
Aspergillus niger CBS 147345 Ani_SJS72_1|g3543.t1
Aspergillus niger CBS 147346 Ani_SJS75_1|g3212.t1 (this protein)
Aspergillus niger CBS 147347 Ani_SJS76_1|g10920.t1
Aspergillus niger CBS 147352 Ani_SJS95_1|g2469.t1
Aspergillus niger CBS 147353 Ani_SJS100_1|g1840.t1
Aspergillus niger CBS 147371 Ani_SJS27_1|g9625.t1
Aspergillus niger CBS 147482 Ani_SJS55_1|g5485.t1
Aspergillus niger CBS 630.78 Ani_SJS18_1|g10818.t1
Aspergillus niger CBS 769.97 Ani_SJS82_1|g9011.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS75_1|g3212.t1
MKPASKHFCCTICQRGFTRIDHLKRHHLRHSGIRPYSCVFCNESFARCDNLRDHYTDCAKRGDQKIPETGQRGRR
RHCTSMKLRCDGLSPCSSCQKRNLRCNNERKQTADNLELVSGSASGKREEYGSSSDRGSIKFLLNGGTDSFTEEF
LLPPRSDRARGLEYHNQKGRQDAEQTMLDFRTGDPSDYAPAFIESDPASLSFFQDTFLDFFNGPFGNVNKIVGDT
YAGGGSFPAMIPSIPDPGLAFTTQPTYEPEEPYAAGLYQAILARAWSVPLDTQAQERLSTYLSFLLTPARIDKFV
RMYLEYWQPSCAMVHFASLNVNTVALPLLAALVFMGATYTTDEQERHAAKQVVDFVELYIFSSETFSPENEVALA
FCGRRMFDGGNNDWIQFQNLQAGFIIVIAQYWSGSPAARNRAMENRFSEVIKIARRMGLPKCRHNQHQAVSEFQW
IQTESRIRTMSIILLLDCAFSFFQNYPCRLSHIEVECDFPCAESLFALEHPYSDRNFQASRGITILEAFHNLFED
DPKDTMPSTPDSSASGSMANLTVLDMFILIHVLYTFINSHMALLGPILRRTQMSHPKHLFSFDAADKSQPGAIPD
DLMLSNIRVALARWREHWVTLSNTLSSREWASMGFFKNGYNFWLVSQLLITKKKSVDVVMQMEVNCEDKLQKLKV
LLDEND*
Coding >Ani_SJS75_1|g3212.t1
ATGAAGCCCGCGAGCAAGCATTTCTGCTGCACCATCTGTCAGCGGGGTTTCACCCGCATTGACCATCTCAAGCGA
CATCATCTCCGCCATTCCGGTATTAGGCCTTATTCCTGCGTTTTCTGCAACGAATCCTTTGCGCGTTGTGACAAC
CTCCGCGATCACTACACGGACTGTGCCAAGCGCGGAGATCAAAAGATCCCTGAGACAGGCCAAAGAGGCCGGAGG
CGACATTGCACATCGATGAAACTGCGTTGCGATGGACTGAGCCCATGCAGCTCGTGTCAGAAGCGGAACCTACGG
TGTAACAATGAGCGCAAGCAAACAGCCGACAACCTGGAGCTGGTCTCGGGCTCGGCCTCGGGGAAGCGTGAGGAG
TACGGATCTTCCTCGGATCGCGGGTCGATCAAGTTCCTCCTCAACGGTGGTACGGACAGTTTCACGGAGGAGTTC
CTCCTTCCGCCCCGCAGTGATCGCGCTCGCGGTCTTGAGTACCATAATCAGAAGGGCCGACAAGATGCGGAGCAG
ACCATGCTCGACTTTCGGACAGGTGATCCGTCAGACTATGCCCCCGCGTTCATCGAGTCGGACCCGGCTTCCCTC
TCGTTCTTCCAGGATACCTTTCTTGATTTCTTTAACGGTCCGTTCGGAAATGTGAACAAAATAGTCGGTGATACC
TATGCAGGTGGAGGCAGCTTCCCCGCCATGATCCCCTCGATACCGGATCCCGGCCTCGCATTCACCACGCAACCT
ACCTATGAGCCGGAAGAACCGTATGCAGCCGGACTGTATCAGGCGATTCTAGCACGGGCGTGGTCGGTCCCTCTC
GATACCCAAGCGCAGGAGCGTTTGTCCACGTATCTAAGCTTTTTGTTGACGCCTGCTCGCATCGACAAGTTCGTA
CGGATGTATCTGGAGTACTGGCAGCCAAGTTGTGCCATGGTTCACTTTGCGTCACTGAATGTGAACACCGTAGCG
TTACCACTACTTGCAGCACTCGTGTTCATGGGCGCGACGTACACAACTGATGAGCAGGAGAGGCATGCTGCAAAG
CAGGTGGTCGATTTTGTAGAGCTCTACATCTTCTCCAGCGAGACCTTCTCACCGGAGAATGAGGTGGCTTTGGCA
TTCTGTGGACGTCGGATGTTTGACGGCGGGAATAATGATTGGATCCAGTTTCAGAATCTTCAGGCTGGCTTCATC
ATTGTCATTGCGCAGTACTGGTCGGGAAGCCCAGCGGCGCGCAATCGAGCGATGGAAAACCGGTTCAGCGAAGTC
ATCAAGATCGCTCGTCGAATGGGCCTTCCCAAATGCCGTCATAACCAACATCAGGCTGTCTCGGAATTCCAATGG
ATCCAGACAGAGTCTCGCATTCGTACAATGAGCATCATTCTGCTGCTCGACTGTGCATTCTCCTTCTTCCAAAAC
TACCCTTGCCGTCTGTCCCATATTGAAGTCGAGTGTGACTTCCCTTGCGCCGAGTCCCTCTTCGCTCTCGAGCAC
CCATACTCGGATCGGAACTTCCAGGCCTCGAGGGGGATCACAATTCTGGAAGCGTTCCACAATTTATTCGAGGAT
GACCCCAAGGACACGATGCCTTCAACACCGGACTCGTCAGCGTCCGGCAGTATGGCGAACCTGACAGTACTCGAC
ATGTTCATACTGATCCACGTCTTGTACACTTTTATCAATTCGCACATGGCCTTACTGGGTCCTATTCTCCGAAGG
ACCCAGATGTCTCACCCGAAGCATCTCTTCAGCTTCGATGCCGCAGACAAGAGCCAGCCCGGAGCGATCCCTGAC
GACCTCATGCTATCCAATATCCGAGTAGCACTGGCCCGATGGCGCGAGCACTGGGTGACGCTGAGCAACACACTG
TCCAGCCGCGAATGGGCCTCGATGGGCTTCTTCAAGAACGGGTACAATTTCTGGTTGGTCTCCCAACTGCTCATC
ACAAAGAAGAAGAGCGTGGACGTGGTGATGCAGATGGAGGTCAACTGTGAGGACAAGTTGCAGAAGCTAAAGGTT
CTGCTTGATGAGAATGACTGA
Transcript >Ani_SJS75_1|g3212.t1
ATGAAGCCCGCGAGCAAGCATTTCTGCTGCACCATCTGTCAGCGGGGTTTCACCCGCATTGACCATCTCAAGCGA
CATCATCTCCGCCATTCCGGTATTAGGCCTTATTCCTGCGTTTTCTGCAACGAATCCTTTGCGCGTTGTGACAAC
CTCCGCGATCACTACACGGACTGTGCCAAGCGCGGAGATCAAAAGATCCCTGAGACAGGCCAAAGAGGCCGGAGG
CGACATTGCACATCGATGAAACTGCGTTGCGATGGACTGAGCCCATGCAGCTCGTGTCAGAAGCGGAACCTACGG
TGTAACAATGAGCGCAAGCAAACAGCCGACAACCTGGAGCTGGTCTCGGGCTCGGCCTCGGGGAAGCGTGAGGAG
TACGGATCTTCCTCGGATCGCGGGTCGATCAAGTTCCTCCTCAACGGTGGTACGGACAGTTTCACGGAGGAGTTC
CTCCTTCCGCCCCGCAGTGATCGCGCTCGCGGTCTTGAGTACCATAATCAGAAGGGCCGACAAGATGCGGAGCAG
ACCATGCTCGACTTTCGGACAGGTGATCCGTCAGACTATGCCCCCGCGTTCATCGAGTCGGACCCGGCTTCCCTC
TCGTTCTTCCAGGATACCTTTCTTGATTTCTTTAACGGTCCGTTCGGAAATGTGAACAAAATAGTCGGTGATACC
TATGCAGGTGGAGGCAGCTTCCCCGCCATGATCCCCTCGATACCGGATCCCGGCCTCGCATTCACCACGCAACCT
ACCTATGAGCCGGAAGAACCGTATGCAGCCGGACTGTATCAGGCGATTCTAGCACGGGCGTGGTCGGTCCCTCTC
GATACCCAAGCGCAGGAGCGTTTGTCCACGTATCTAAGCTTTTTGTTGACGCCTGCTCGCATCGACAAGTTCGTA
CGGATGTATCTGGAGTACTGGCAGCCAAGTTGTGCCATGGTTCACTTTGCGTCACTGAATGTGAACACCGTAGCG
TTACCACTACTTGCAGCACTCGTGTTCATGGGCGCGACGTACACAACTGATGAGCAGGAGAGGCATGCTGCAAAG
CAGGTGGTCGATTTTGTAGAGCTCTACATCTTCTCCAGCGAGACCTTCTCACCGGAGAATGAGGTGGCTTTGGCA
TTCTGTGGACGTCGGATGTTTGACGGCGGGAATAATGATTGGATCCAGTTTCAGAATCTTCAGGCTGGCTTCATC
ATTGTCATTGCGCAGTACTGGTCGGGAAGCCCAGCGGCGCGCAATCGAGCGATGGAAAACCGGTTCAGCGAAGTC
ATCAAGATCGCTCGTCGAATGGGCCTTCCCAAATGCCGTCATAACCAACATCAGGCTGTCTCGGAATTCCAATGG
ATCCAGACAGAGTCTCGCATTCGTACAATGAGCATCATTCTGCTGCTCGACTGTGCATTCTCCTTCTTCCAAAAC
TACCCTTGCCGTCTGTCCCATATTGAAGTCGAGTGTGACTTCCCTTGCGCCGAGTCCCTCTTCGCTCTCGAGCAC
CCATACTCGGATCGGAACTTCCAGGCCTCGAGGGGGATCACAATTCTGGAAGCGTTCCACAATTTATTCGAGGAT
GACCCCAAGGACACGATGCCTTCAACACCGGACTCGTCAGCGTCCGGCAGTATGGCGAACCTGACAGTACTCGAC
ATGTTCATACTGATCCACGTCTTGTACACTTTTATCAATTCGCACATGGCCTTACTGGGTCCTATTCTCCGAAGG
ACCCAGATGTCTCACCCGAAGCATCTCTTCAGCTTCGATGCCGCAGACAAGAGCCAGCCCGGAGCGATCCCTGAC
GACCTCATGCTATCCAATATCCGAGTAGCACTGGCCCGATGGCGCGAGCACTGGGTGACGCTGAGCAACACACTG
TCCAGCCGCGAATGGGCCTCGATGGGCTTCTTCAAGAACGGGTACAATTTCTGGTTGGTCTCCCAACTGCTCATC
ACAAAGAAGAAGAGCGTGGACGTGGTGATGCAGATGGAGGTCAACTGTGAGGACAAGTTGCAGAAGCTAAAGGTT
CTGCTTGATGAGAATGACTGA
Gene >Ani_SJS75_1|g3212.t1
ATGAAGCCCGCGAGCAAGCATTTCTGCTGCACCATCTGTCAGCGGGGTTTCACCCGCATTGACCATCTCAAGCGA
CATCATCTCCGCCGTACGCTCCCTCCCTTCCTGCATCTCGGCCCGCTTCTGGCTCGTGTCTGGCTCATTTCTGGC
TCATCCTTCAATGCTTGTCGTGCGCTAACCTAAACGCTGCCCGTCAGATTCCGGTATTAGGCCTTATTCCTGCGT
TTTCTGCAACGAATCCTTTGCGCGTTGGTTCGTGTCTTGCTCTCCCTCCCGCCCCTGGCTCTCGTCGGTTTCCCG
ACCGACGCTTGTATGTTTGCCATGATCGTTCCCCACAACTACGATACTGATGCGTTCACTCAATCTTCAGTGACA
ACCTCCGCGATCACTACACGGACTGTGCCAAGCGCGGAGATCAAAAGATCCCTGAGACAGGCCAAAGAGGCCGGA
GGCGACATGTCTGTCAGTCGGCAAGTTCCCCCCTGATCCCCCGCCGATCGCATACCCAGCCTATTGTGCGCGCAT
GGTCGCTAATTGTCGGAATTTAGTGCACATCGATGAAACTGCGTTGCGATGGACTGAGCCCATGCAGCTCGTGTC
AGAAGCGGAACCTACGGTGTAACAATGAGCGCAAGCAAACAGCCGACAACCTGGAGCTGGTCTCGGGCTCGGCCT
CGGGGAAGCGTGAGGAGTACGGATCTTCCTCGGATCGCGGGTCGATCAAGTTCCTCCTCAACGGTGGTACGGACA
GTTTCACGGAGGAGTTCCTCCTTCCGCCCCGCAGTGATCGCGCTCGCGGTCTTGAGTACCATAATCAGAAGGGCC
GACAAGATGCGGAGCAGACCATGCTCGACTTTCGGACAGGTGATCCGTCAGACTATGCCCCCGCGTTCATCGAGT
CGGACCCGGCTTCCCTCTCGTTCTTCCAGGATACCTTTCTTGATTTCTTTAACGGTCCGTTCGGAAATGTGAACA
AAATAGTCGGTGATACCTATGCAGGTGGAGGCAGCTTCCCCGCCATGATCCCCTCGATACCGGATCCCGGCCTCG
CATTCACCACGCAACCTACCTATGAGCCGGAAGAACCGTATGCAGCCGGACTGTATCAGGCGATTCTAGCACGGG
CGTGGTCGGTCCCTCTCGATACCCAAGCGCAGGAGCGTTTGTCCACGTATCTAAGCTTTTTGTTGACGCCTGCTC
GCATCGACAAGTTCGTACGGATGTATCTGGAGTACTGGCAGCCAAGTTGTGCCATGGTTCACTTTGCGTCACTGA
ATGTGAACACCGTAGCGTTACCACTACTTGCAGCACTCGTGTTCATGGGCGCGACGTACACAACTGATGAGCAGG
AGAGGCATGCTGCAAAGCAGGTGGTCGATTTTGTAGAGCTCTACATCTTCTCCAGCGAGACCTTCTCACCGGAGA
ATGAGGTGGCTTTGGCATTCTGTGGACGTCGGATGTTTGACGGCGGGAATAATGATTGGATCCAGTTTCAGAATC
TTCAGGCTGGCTTCATCATTGTCATTGCGCAGTACTGGTCGGGAAGCCCAGCGGCGCGCAATCGAGCGATGGAAA
ACCGGTTCAGCGAAGTCATCAAGGTATGTAGTCGGATATGCAGACGGGTGACGTTACTGACGTGAGTAGATCGCT
CGTCGAATGGGCCTTCCCAAATGCCGTCATAACCAACATCAGGCTGTCTCGGAATTCCAATGGATCCAGACAGAG
TCTCGCATTCGGTATGTCTCCGTCCCCCTTTCTGGTTTACCCCGCTGACCGTAGCAGTACAATGAGCATCATTCT
GCTGCTCGACTGTGCATTCTCCTTCTTCCAAAACTACCCTTGCCGTCTGTCCCATATTGAAGTCGAGTGTGACTT
CCCTTGCGCCGAGTCCCTCTTCGCTCTCGAGCACCCATACTCGGATCGGAACTTCCAGGCCTCGAGGGGGATCAC
AATTCTGGAAGCGTTCCACAATTTATTCGAGGATGACCCCAAGGACACGATGCCTTCAACACCGGACTCGTCAGC
GTCCGGCAGTATGGCGAACCTGACAGTACTCGACATGTTCATACTGATCCACGGTACGTCAAGCCATCGATAGCA
CATGACCGTTAAGCTGACTGCTCTAGTCTTGTACACTTTTATCAATTCGCACATGGCCTTACTGGGTCCTATTCT
CCGAAGGACCCAGATGTCTCACCCGAAGCATCTCTTCAGCTTCGATGCCGCAGACAAGAGCCAGCCCGGAGCGAT
CCCTGACGACCTCATGCTATCCAATATCCGAGTAGCACTGGCCCGATGGCGCGAGCACTGGGTGACGCTGAGCAA
CACACTGTCCAGCCGCGAATGGGCCTCGATGGGCTTCTTCAAGAACGGGTACAATTTCTGGTTGGTCTCCCAACT
GCTCATCACAAAGAAGAAGAGCGTGGACGTGGTGATGCAGATGGAGGTCAACTGTGAGGACAAGTTGCAGAAGCT
AAAGGTTCTGCTTGATGAGAATGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail