Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS75_1|g2417.t1
Gene name
Locationscaffold_012:277505..278629
Strand+
Gene length (bp)1124
Transcript length (bp)846
Coding sequence length (bp)846
Protein length (aa) 282

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11807 UstYa Mycotoxin biosynthesis protein UstYa 7.1E-42 32 239

GO

GO Term Description Terminal node
GO:0043386 mycotoxin biosynthetic process Yes
GO:0009404 toxin metabolic process No
GO:0009987 cellular process No
GO:0044249 cellular biosynthetic process No
GO:0008150 biological_process No
GO:0009403 toxin biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0019748 secondary metabolic process No
GO:0043385 mycotoxin metabolic process No
GO:0009058 biosynthetic process No
GO:0008152 metabolic process No
GO:0044550 secondary metabolite biosynthetic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 44 66 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID3
Orthogroup10774
Change Orthofinder run
Species Protein ID
Aspergillus niger CBS 113.50 Ani_SJS3_1|g4760.t1
Aspergillus niger CBS 124.48 Ani_SJS7_1|g2542.t1
Aspergillus niger CBS 133816 Ani_SJS71_1|g1897.t1
Aspergillus niger CBS 147320 Ani_SJS28_1|g4187.t1
Aspergillus niger CBS 147321 Ani_SJS30_1|g5790.t1
Aspergillus niger CBS 147322 Ani_SJS35_1|g6844.t1
Aspergillus niger CBS 147323 Ani_SJS38_1|g1059.t1
Aspergillus niger CBS 147324 Ani_SJS39_1|g2142.t1
Aspergillus niger CBS 147343 Ani_SJS115_1|g4760.t1
Aspergillus niger CBS 147344 Ani_SJS70_1|g2794.t1
Aspergillus niger CBS 147345 Ani_SJS72_1|g2875.t1
Aspergillus niger CBS 147346 Ani_SJS75_1|g2417.t1 (this protein)
Aspergillus niger CBS 147347 Ani_SJS76_1|g83.t1
Aspergillus niger CBS 147352 Ani_SJS95_1|g2963.t1
Aspergillus niger CBS 147353 Ani_SJS100_1|g5843.t1
Aspergillus niger CBS 147371 Ani_SJS27_1|g4358.t1
Aspergillus niger CBS 147482 Ani_SJS55_1|g2600.t1
Aspergillus niger CBS 630.78 Ani_SJS18_1|g2278.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS75_1|g2417.t1
MDSEQTSSESPFLPKKMLRDSFESEHPPRPFQNVSWFQRNQKCLLSNVVVIAVCVTLGAMYHHSYLGRLQCAPQS
LIYTPARNSLEYVKVRMDTAGGHQSKYLGFGDEADEAWTDLTSRNHVRLSEEDLLAINQTSVPLGSGGYLGMLGV
YHELHCVKWIRWALNQSKYQDSLSDHDIIDLPAHISHCVDIVRQSVMCRANTAIVTYSWIKESRVPKTDFHAYSQ
CVDWDKFEAWADKHTVDILGPGELNHPIYGQTFPNRHRLEEDGKIPAILPALEYGT*
Coding >Ani_SJS75_1|g2417.t1
ATGGATTCGGAACAGACCAGCTCAGAATCTCCATTTCTTCCCAAGAAGATGTTAAGAGACAGTTTCGAAAGCGAG
CATCCGCCTCGACCTTTTCAGAACGTCTCATGGTTTCAAAGAAACCAAAAATGTCTTCTCTCGAACGTTGTCGTG
ATTGCAGTGTGTGTTACACTAGGAGCAATGTATCATCACTCGTATCTGGGTAGATTACAATGTGCTCCGCAGAGC
TTGATCTACACGCCGGCACGAAATAGCCTCGAGTACGTCAAGGTGCGGATGGATACAGCTGGTGGCCATCAAAGC
AAGTATTTAGGCTTCGGTGATGAGGCTGATGAGGCATGGACGGATCTCACGTCAAGGAATCACGTCAGGCTTAGT
GAAGAGGACTTGCTCGCCATCAATCAGACATCGGTTCCCCTCGGAAGCGGCGGTTACCTTGGTATGCTCGGAGTT
TACCACGAGCTACATTGCGTGAAATGGATCCGTTGGGCCCTCAACCAATCTAAATATCAAGATTCATTATCTGAT
CATGATATAATTGACCTTCCCGCTCACATTAGTCATTGTGTTGATATTGTACGCCAGAGTGTCATGTGCCGTGCA
AACACGGCTATTGTCACCTATTCCTGGATTAAGGAGAGCCGAGTTCCGAAGACGGACTTCCACGCCTATAGCCAA
TGTGTAGATTGGGATAAATTTGAAGCTTGGGCTGATAAGCACACTGTTGACATCCTTGGACCGGGAGAGCTTAAT
CATCCAATTTACGGTCAAACATTTCCTAACAGACACCGATTGGAGGAAGATGGGAAAATTCCTGCAATCCTTCCT
GCTTTGGAATATGGAACTTAG
Transcript >Ani_SJS75_1|g2417.t1
ATGGATTCGGAACAGACCAGCTCAGAATCTCCATTTCTTCCCAAGAAGATGTTAAGAGACAGTTTCGAAAGCGAG
CATCCGCCTCGACCTTTTCAGAACGTCTCATGGTTTCAAAGAAACCAAAAATGTCTTCTCTCGAACGTTGTCGTG
ATTGCAGTGTGTGTTACACTAGGAGCAATGTATCATCACTCGTATCTGGGTAGATTACAATGTGCTCCGCAGAGC
TTGATCTACACGCCGGCACGAAATAGCCTCGAGTACGTCAAGGTGCGGATGGATACAGCTGGTGGCCATCAAAGC
AAGTATTTAGGCTTCGGTGATGAGGCTGATGAGGCATGGACGGATCTCACGTCAAGGAATCACGTCAGGCTTAGT
GAAGAGGACTTGCTCGCCATCAATCAGACATCGGTTCCCCTCGGAAGCGGCGGTTACCTTGGTATGCTCGGAGTT
TACCACGAGCTACATTGCGTGAAATGGATCCGTTGGGCCCTCAACCAATCTAAATATCAAGATTCATTATCTGAT
CATGATATAATTGACCTTCCCGCTCACATTAGTCATTGTGTTGATATTGTACGCCAGAGTGTCATGTGCCGTGCA
AACACGGCTATTGTCACCTATTCCTGGATTAAGGAGAGCCGAGTTCCGAAGACGGACTTCCACGCCTATAGCCAA
TGTGTAGATTGGGATAAATTTGAAGCTTGGGCTGATAAGCACACTGTTGACATCCTTGGACCGGGAGAGCTTAAT
CATCCAATTTACGGTCAAACATTTCCTAACAGACACCGATTGGAGGAAGATGGGAAAATTCCTGCAATCCTTCCT
GCTTTGGAATATGGAACTTAG
Gene >Ani_SJS75_1|g2417.t1
ATGGATTCGGAACAGACCAGCTCAGAATCTCCATTTCTTCCCAAGAAGATGTTAAGAGACAGTTTCGAAAGCGAG
CATCCGCCTCGACCTTTTCAGAACGTCTCATGGTTTCAAAGAAACCAAAAATGTCTTCTCTCGAACGTTGTCGTG
ATTGCAGTGTGTGTTACACTAGGAGCAATGTATCATCACTCGTATCTGGGTAGATTACAATGTGCTCCGCAGAGC
TTGATCTACAGTGAGACTGGCATACACCCATCTATCGCACGGGAACCCATGTTGACTTTTGCCCTTTATAGCGCC
GGCACGAAATAGCCTCGAGTACGTCAAGGTGCGGATGGATACAGCTGGTGGCCATCAAAGCAAGTATTTAGGCTT
CGGTGATGAGGCTGATGAGGCATGGACGGATCTCACGTCAAGTAGATATGCCCCATGAACTGGGCTGTGTCATCC
AACACTGACACCTCGCCTAGGGAATCACGTCAGGCTTAGTGAAGAGGACTTGCTCGCCATCAATCAGACATCGGT
TCCCCTCGGAAGCGGCGGTTACCTTGGTATGCTCGGAGTTTACCACGAGCTACATTGCGTGGTGAGCGATGCAAA
GTCTTCGGTTATATATTCATTATATACTAAGTTTCCTTGCCAGAAATGGATCCGTTGGGCCCTCAACCAATCTAA
ATATCAAGATTCATTATCTGATCATGATATAATTGACCTTCCCGCTCACATTAGTATGATTGTACCTATCAACAC
CACTTACTTTGGATATATGCTAAATTACAAGTAGGTCATTGTGTTGATATTGTACGCCAGAGTGTCATGTGCCGT
GCAAACACGGCTATTGTCACCTATTCCTGGATTAAGGAGAGCCGAGTTCCGAAGACGGACTTCCACGCCTATAGC
CAATGTGTAGATTGGGATAAATTTGAAGCTTGGGCTGATAAGCACACTGTTGACATCCTTGGACCGGGAGAGCTT
AATCATCCAATTTACGGTACGTAACTTGCCTACATTGTAGAGCGCGCTAACATGCCTCGATTATAGGTCAAACAT
TTCCTAACAGACACCGATTGGAGGAAGATGGGAAAATTCCTGCAATCCTTCCTGCTTTGGAATATGGAACTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail