Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS75_1|g128.t1
Gene name
Locationscaffold_001:414769..422380
Strand-
Gene length (bp)7611
Transcript length (bp)7032
Coding sequence length (bp)7032
Protein length (aa) 2344

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00521 DNA_topoisoIV DNA gyrase/topoisomerase IV, subunit A 7.8E-139 809 1261
PF16898 TOPRIM_C C-terminal associated domain of TOPRIM 2.5E-53 676 807
PF00204 DNA_gyraseB DNA gyrase B 1.0E-26 368 532
PF07690 MFS_1 Major Facilitator Superfamily 2.0E-23 1864 2146
PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 1.6E-15 182 326
PF01751 Toprim Toprim domain 2.1E-06 562 660
PF00083 Sugar_tr Sugar (and other) transporter 2.6E-05 1883 2153

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0003918 DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity Yes
GO:0005524 ATP binding Yes
GO:0022857 transmembrane transporter activity Yes
GO:0003677 DNA binding Yes
GO:0055085 transmembrane transport Yes
GO:0006265 DNA topological change Yes
GO:0051179 localization No
GO:0043170 macromolecule metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0046483 heterocycle metabolic process No
GO:0016043 cellular component organization No
GO:0005215 transporter activity No
GO:0009987 cellular process No
GO:0006807 nitrogen compound metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0005488 binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0006725 cellular aromatic compound metabolic process No
GO:0017076 purine nucleotide binding No
GO:0071840 cellular component organization or biogenesis No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0031224 intrinsic component of membrane No
GO:0044237 cellular metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0071704 organic substance metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0044238 primary metabolic process No
GO:0036094 small molecule binding No
GO:0008094 ATP-dependent activity, acting on DNA No
GO:0008150 biological_process No
GO:0071103 DNA conformation change No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0003674 molecular_function No
GO:0090304 nucleic acid metabolic process No
GO:0006996 organelle organization No
GO:0140657 ATP-dependent activity No
GO:0003916 DNA topoisomerase activity No
GO:0006810 transport No
GO:0005575 cellular_component No
GO:0003824 catalytic activity No
GO:0051234 establishment of localization No
GO:0140097 catalytic activity, acting on DNA No
GO:0032553 ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0008152 metabolic process No
GO:0016853 isomerase activity No
GO:0003676 nucleic acid binding No
GO:0006259 DNA metabolic process No
GO:0051276 chromosome organization No
GO:1901360 organic cyclic compound metabolic process No
GO:0110165 cellular anatomical entity No
GO:0140640 catalytic activity, acting on a nucleic acid No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 1857 1879 22
2 1891 1913 22
3 1923 1945 22
4 1980 2002 22
5 2012 2031 19
6 2088 2107 19
7 2127 2149 22
8 2214 2236 22
9 2246 2268 22
10 2275 2297 22
11 2307 2329 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID3
Orthogroup2645
Change Orthofinder run
Species Protein ID
Aspergillus niger CBS 112.32 Ani_SJS6_1|g9244.t1
Aspergillus niger CBS 113.50 Ani_SJS3_1|g878.t1
Aspergillus niger CBS 115988 Ani_SJS16_1|g2566.t1
Aspergillus niger CBS 115989 Ani_SJS83_1|g2112.t1
Aspergillus niger CBS 118.52 Ani_SJS14_1|g756.t1
Aspergillus niger CBS 124.48 Ani_SJS7_1|g1990.t1
Aspergillus niger CBS 131.52 Ani_SJS8_1|g4683.t1
Aspergillus niger CBS 133816 Ani_SJS71_1|g2027.t1
Aspergillus niger CBS 147320 Ani_SJS28_1|g6386.t1
Aspergillus niger CBS 147321 Ani_SJS30_1|g5059.t1
Aspergillus niger CBS 147322 Ani_SJS35_1|g7213.t1
Aspergillus niger CBS 147323 Ani_SJS38_1|g222.t1
Aspergillus niger CBS 147324 Ani_SJS39_1|g946.t1
Aspergillus niger CBS 147343 Ani_SJS115_1|g391.t1
Aspergillus niger CBS 147344 Ani_SJS70_1|g4017.t1
Aspergillus niger CBS 147345 Ani_SJS72_1|g571.t1
Aspergillus niger CBS 147346 Ani_SJS75_1|g128.t1 (this protein)
Aspergillus niger CBS 147347 Ani_SJS76_1|g6617.t1
Aspergillus niger CBS 147352 Ani_SJS95_1|g533.t1
Aspergillus niger CBS 147353 Ani_SJS100_1|g239.t1
Aspergillus niger CBS 147371 Ani_SJS27_1|g1917.t1
Aspergillus niger CBS 147482 Ani_SJS55_1|g245.t1
Aspergillus niger CBS 630.78 Ani_SJS18_1|g663.t1
Aspergillus niger CBS 769.97 Ani_SJS82_1|g1820.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS75_1|g128.t1
MDDSIMDDSVFDDEGSSDFVPEPAPKPKAKAAPKKAASKAAPKKLTQTTLTTKTTSKAASKKRAKPDSDDDDIMD
DDDDHMSDDSVLSHTPPKKAKKTAGPSKKGGAKPLADVENESFGKDDSVEPGKSNNASEKYQKLTQLEHIIKRPD
TYIGSVERTTQQMWVYSSESDGMEYREVSYVPGLYKIFDEIVVNAADNKQNDENMSEIRVTVDRESGVISVWNNG
RGIPIEMHAKEKIYVPELIFGHLLTSSNYDDTQQKVTGGRNGFGAKLCNVFSTEFSIETQDSSQKKKYRQTWTEN
MTKIGKAKITEAKGEDYTKVTFKPDYAKFGMDGMDDDFEALVKRRVYDLAGTAKVNVKLNGTRIPIRGFKKYMEM
YTKAIRKERGDTGPAPKDEIITCSPDPRWEVGFAVSDGAFQQVSFVNSIATTSGGTHVNYIADQICNRLAEQVKK
KNKNGATLKTAQIRNHIFIFVNALIVNPAFTSQTKEQLTTKASQFGSKCVLDEDFYKKVLKTAVMDNILHFAQQK
ADQMLKKTDGGRRSRMNNPKLTDANKAGTKDGHHCTLILTEGDSAKGLAMAGRAVVGPDLFGVFPLRGKLLNVRD
ASFDQISKNQEIQNIKNFLGLQHKKEYTDTRGLRYGHLMIMTDQDHDGSHIKGLLINFLQAQFPSLLKIPEFLIE
FITPIVKVWKGDPKNPTKQRSFFTMPEYEAWAEEHQHERGWDHKYYKGLGTSTTEDAQVYFRDLDRHLKEFHTMQ
DNEAELIELAFSKKKADERKEWLRQFKPGTFLDHSVEKITYTDFINKELILFSMADNVRSIPSVVDGLKPGQRKV
LYTCFRRNLKKDMKVVELAGHVSGMTAYQHGDVSLQQTIVGLAQTFVGSNNINCLEPSGNFGSRLQGGSDCASAR
YIYTRLSPFARRIFHASDEPLLTYNVDDGKTIEPEVYMPVVPMILINGADGIGTGWSSSIPNYNPEDVVDNLKRL
MNGEEIKPMQPWFRGFTGEVTSIGGDRFKFSGIIKETGEKEVEITELPIRTWTQDFKDKLEDIIKAEKTPSFIKD
YKDYNTHTKVHFVIQMDEKHLKSAVEEGLEEKFKLTKTIATTNLVAFDPEGRITKYATVDDILKEFFAVRLKYYE
RRKQYQLNEMQKELEKLSNQARFVQMIIDGELVVSKKKKNVLVVELKDKGFKPFPKVADAAKAGEAEPAAEDEEE
SEDVDDTSNLSNAYDYLLGMAIWSLTQERVERLRRQIGDKEMEIDTLIKLSKEDIWKRDLDDFINEWRFQLDDEA
RRMRKVANMGRRTSSKLMTAVGRGGARKRKAAKDDDSDDEDFAAPKTKRGPKKAEPKGTLHSFLNKSSPKPKPAA
DDDDDDDDFEMEVMPKKNRGASKPAAPAKEEEKETGESDVEILPKKSRAAPKAASKVKAEDPDSTEVKKAPAKRG
RPAAKAKAKPAEEEIELDDDEFMEITKAQAAETSKADPAPSRARKPAKYTLSDSDSDNGDDLLGDVSKMVKGIGG
TTGGSTSDSRQLFSERSGTGSTSGLASSSKASKQSPDFDADETDYSKLVPQSSPRRSLQVKSKETKTLVDSDEEE
DEPVKPAATKAKPAARGKAAAAKPAAKPRGRPKKDATTTTAASAKQTALSPAAKAYASKQAKTTGKKKQLADDLS
DDDIDAMANDILDSPAAPTTRPSRRTATAKKKTYVIDDDSDDFGAGGDSEDDFAEDSELDFEVSFFLCLSRKRPA
VERDCDYPDLSYRPRLDWPLFSTVWSQDLRSSFVSKAYLQYRRIGHAVRQQLEDFPEFARPGVAKDDLPEGIPRD
APNAVSRRRSSPLLPGVQLKDVVENDGSSSSVLLVDWDGDHDPINPRNYSRATRIGATLMVSALGFAVGAASSIE
SGVLPQNAAAFNISDVVASLATGMYLLGFAAGSLVSGPLSEILGRNAVYTGSLTLFMIFVMASGLAPNIGAQLAF
RFLAGIFGCPPLTCAGGTIADLWNPLEKTLFFPLYAILSFGGPVLGPVIASYMGEGTLSWRWTNWIILILAGFIL
ALILLLQPETYGPLLLKWKAHHLRQQTGDNRYRSSMDLQETALFSRIGTACMRQFALTIHEPIILLISLYMTVIY
IVLFTFFDGYTYIFSDVHGLSQGLTNIVWVAMYVGISMAGLFVPVVYVWTKREFSDAAASAAASAAASPRSASSE
IVTADPNANGADTSEKPNLDDDDTQKPTQQHKHVARPENRLWFAMLGSPAIPIGLFWMGWTDYSSISIWSPIIAS
TVFGFGTICVFISSYMYVIDAYDIYAASALGFMTVSRYCAAGGMTVVGIPFYSNMGVHWTLTILGAISALMTPVP
YVFYRYGVVIRGWSRYAV*
Coding >Ani_SJS75_1|g128.t1
ATGGACGATTCGATCATGGACGACTCCGTCTTCGACGACGAAGGAAGCTCCGACTTCGTCCCCGAGCCCGCTCCG
AAGCCCAAGGCCAAGGCAGCCCCCAAGAAGGCAGCTTCTAAGGCAGCGCCTAAGAAGCTCACTCAGACCACCCTC
ACTACGAAGACCACATCCAAGGCGGCTTCGAAAAAACGTGCCAAACCGGACAGCGATGACGACGACATTATGGAC
GACGATGACGATCACATGTCCGACGACTCTGTTCTGTCGCACACCCCTCCCAAGAAGGCTAAGAAGACGGCTGGT
CCCTCCAAGAAGGGCGGCGCTAAGCCCCTCGCGGATGTGGAAAATGAATCATTTGGAAAAGATGATTCCGTAGAG
CCCGGAAAGTCCAACAATGCATCAGAGAAGTACCAGAAGCTTACACAACTTGAACACATCATTAAACGTCCCGAT
ACATATATTGGCTCCGTCGAACGCACGACGCAGCAAATGTGGGTATACAGTTCGGAGTCGGACGGAATGGAGTAC
CGTGAAGTCTCCTATGTGCCCGGTCTCTACAAGATCTTCGATGAAATTGTCGTCAACGCAGCCGATAACAAACAG
AATGACGAGAATATGAGCGAGATCCGCGTGACGGTCGACCGTGAGTCGGGCGTGATCAGTGTCTGGAACAATGGC
CGCGGTATTCCCATCGAAATGCATGCCAAGGAAAAGATCTACGTCCCCGAGTTGATCTTTGGTCATCTCCTCACC
TCCTCCAACTACGATGACACGCAACAGAAGGTCACCGGTGGTCGTAACGGTTTCGGTGCCAAGCTCTGTAACGTT
TTCTCCACTGAGTTCTCCATCGAGACTCAGGACTCGTCTCAGAAGAAGAAATATAGGCAGACATGGACGGAAAAC
ATGACCAAGATTGGCAAGGCCAAGATTACCGAGGCCAAGGGAGAAGACTACACCAAGGTCACGTTCAAGCCAGAC
TACGCCAAATTCGGCATGGACGGCATGGATGATGACTTCGAGGCTCTTGTCAAGCGTCGTGTGTATGACCTGGCA
GGCACTGCAAAGGTGAATGTCAAGCTAAACGGCACTCGCATCCCTATCCGCGGCTTCAAGAAGTACATGGAGATG
TACACCAAGGCTATTCGTAAGGAACGTGGAGACACTGGTCCCGCCCCGAAGGACGAGATTATTACTTGCAGCCCA
GACCCTCGCTGGGAGGTCGGTTTCGCCGTTTCCGATGGCGCTTTCCAACAGGTGTCCTTCGTAAACTCCATTGCG
ACCACCTCTGGTGGTACCCATGTTAACTACATTGCCGATCAGATCTGTAATAGATTGGCTGAGCAAGTGAAAAAG
AAGAATAAAAACGGCGCCACGTTGAAAACAGCCCAGATCCGAAACCACATCTTCATCTTCGTCAACGCACTGATT
GTCAACCCGGCATTCACATCCCAGACCAAAGAACAGCTGACGACTAAGGCTTCCCAATTTGGTAGTAAATGTGTG
CTTGATGAAGACTTCTATAAGAAGGTCCTGAAGACAGCGGTGATGGACAACATCTTGCATTTCGCCCAGCAGAAG
GCCGATCAGATGCTCAAAAAGACGGACGGTGGCCGGCGCTCCCGCATGAACAACCCCAAGTTGACCGATGCCAAC
AAGGCCGGAACCAAGGACGGCCATCACTGCACCCTGATCCTCACAGAAGGTGACTCTGCCAAGGGTCTGGCCATG
GCTGGTCGAGCGGTTGTTGGCCCGGATCTTTTTGGTGTTTTCCCGCTCCGAGGTAAACTGCTCAACGTCCGTGAC
GCTTCCTTCGACCAGATCTCAAAAAATCAGGAAATCCAGAATATCAAGAACTTCTTGGGTCTGCAGCACAAGAAG
GAGTATACCGACACCCGCGGCCTTCGGTACGGTCACTTGATGATCATGACTGATCAGGATCACGACGGTAGTCAC
ATCAAGGGCCTGCTCATCAACTTCCTACAGGCCCAGTTTCCCAGTTTGCTGAAGATTCCCGAGTTCTTGATTGAA
TTCATCACCCCCATTGTAAAGGTGTGGAAGGGTGATCCCAAGAACCCTACCAAACAGCGTTCTTTCTTCACTATG
CCCGAGTACGAGGCATGGGCGGAGGAGCACCAGCATGAGCGTGGTTGGGATCACAAGTACTACAAGGGTTTGGGT
ACCAGTACTACTGAGGATGCCCAGGTCTACTTCCGCGACTTGGACCGTCACCTTAAGGAGTTCCACACCATGCAG
GATAACGAGGCGGAGTTGATCGAGCTGGCTTTCTCGAAGAAGAAGGCTGACGAGCGTAAGGAGTGGCTGCGGCAG
TTCAAGCCCGGAACTTTCTTGGATCATTCCGTCGAGAAGATCACCTACACCGACTTCATCAACAAGGAGCTTATC
CTGTTCAGTATGGCGGACAATGTTCGTTCGATTCCCTCTGTTGTTGACGGTCTGAAGCCTGGTCAGCGTAAGGTT
CTGTACACCTGTTTCCGTCGCAATCTGAAGAAGGACATGAAGGTCGTCGAGTTGGCTGGTCACGTCTCGGGTATG
ACCGCGTACCAGCACGGTGATGTTTCCTTGCAGCAAACCATTGTTGGCCTGGCGCAGACCTTTGTTGGGTCCAAC
AACATCAACTGTCTGGAGCCTAGCGGTAACTTTGGTAGTCGTCTTCAGGGTGGTTCCGACTGCGCCAGTGCGCGT
TATATTTACACGCGGCTGTCCCCGTTCGCGCGCCGCATCTTCCATGCGTCAGACGAGCCTCTACTGACCTACAAC
GTCGACGATGGTAAGACTATCGAGCCTGAGGTCTACATGCCGGTGGTTCCCATGATTCTGATCAACGGTGCGGAC
GGTATCGGTACCGGCTGGAGTTCCTCGATTCCCAACTACAACCCGGAGGACGTCGTGGACAACCTGAAGCGGCTG
ATGAATGGCGAGGAGATCAAACCTATGCAGCCCTGGTTCCGTGGGTTCACAGGTGAGGTCACTTCCATCGGCGGT
GATCGCTTCAAATTCAGCGGTATCATCAAAGAGACTGGTGAGAAGGAAGTAGAGATCACCGAACTGCCCATCCGA
ACTTGGACTCAGGATTTCAAGGATAAGCTTGAAGATATCATCAAGGCGGAAAAGACACCGTCGTTCATCAAGGAC
TACAAGGATTACAACACGCACACCAAGGTTCACTTTGTAATCCAAATGGATGAGAAGCATCTGAAGTCTGCCGTC
GAAGAAGGCTTGGAAGAAAAGTTCAAGCTGACGAAGACCATCGCCACCACGAACTTGGTTGCGTTTGATCCCGAG
GGTCGGATTACCAAATATGCGACAGTGGACGACATTCTGAAGGAATTCTTTGCAGTCCGTCTGAAGTATTACGAG
CGCCGCAAGCAATACCAACTCAACGAAATGCAAAAGGAGCTGGAGAAGCTGAGCAACCAGGCGCGCTTTGTCCAG
ATGATCATCGACGGTGAGCTCGTCGTTTCGAAGAAGAAGAAGAATGTGCTCGTTGTGGAGCTGAAGGACAAGGGC
TTCAAGCCATTCCCCAAGGTGGCGGATGCTGCCAAGGCAGGGGAAGCCGAGCCAGCTGCTGAAGATGAGGAGGAA
TCCGAAGACGTCGATGATACCAGCAATCTTTCCAACGCGTATGACTACCTGCTGGGTATGGCGATCTGGTCGTTG
ACCCAGGAGCGTGTGGAGCGCCTCCGTCGCCAGATTGGTGATAAGGAGATGGAAATTGACACCTTGATCAAGCTT
TCCAAGGAAGATATCTGGAAGCGGGATTTGGATGACTTCATCAACGAATGGCGCTTCCAGCTCGACGATGAAGCT
CGTCGCATGCGTAAGGTGGCAAACATGGGCCGCCGTACCTCCTCCAAGCTGATGACGGCTGTGGGCCGTGGCGGT
GCCCGCAAGCGCAAGGCTGCTAAGGATGATGACTCGGATGATGAAGACTTCGCCGCACCGAAGACCAAGCGCGGT
CCGAAGAAGGCCGAGCCTAAAGGCACGCTCCATAGTTTCTTGAACAAGTCCTCTCCTAAGCCCAAGCCTGCAGCG
GACGACGATGACGACGACGATGATTTTGAAATGGAGGTGATGCCGAAGAAGAATCGCGGGGCCAGCAAGCCGGCA
GCGCCAGCGAAGGAAGAAGAGAAAGAGACAGGCGAATCCGATGTGGAAATCCTGCCGAAGAAGAGTCGGGCTGCA
CCCAAGGCTGCGTCCAAAGTTAAGGCCGAAGATCCCGACAGTACTGAGGTGAAGAAAGCACCAGCTAAACGGGGC
CGTCCGGCGGCCAAAGCGAAGGCCAAGCCAGCGGAAGAGGAGATCGAGCTGGACGACGACGAGTTCATGGAGATC
ACTAAGGCGCAAGCTGCCGAGACTAGCAAGGCTGACCCAGCGCCCAGTCGAGCGCGCAAGCCGGCCAAGTACACC
TTGAGTGACTCGGACAGCGACAACGGGGACGACCTCCTGGGCGACGTGAGCAAAATGGTCAAGGGGATCGGCGGC
ACTACCGGCGGATCGACATCGGACTCCCGGCAGCTGTTCTCGGAGCGCTCTGGGACCGGCAGCACCTCGGGACTG
GCCAGCAGCTCCAAGGCCTCGAAGCAGTCTCCCGATTTTGACGCAGACGAGACTGACTACAGCAAGCTCGTCCCA
CAGAGCTCTCCGCGCCGGTCGCTGCAGGTTAAGTCCAAGGAGACCAAGACGTTAGTTGACAGCGATGAGGAGGAG
GATGAGCCAGTGAAGCCGGCCGCTACCAAGGCCAAGCCGGCGGCCCGAGGCAAGGCAGCGGCAGCCAAACCGGCC
GCGAAGCCACGAGGACGGCCAAAGAAGGATGCCACCACCACGACGGCTGCATCTGCTAAGCAGACGGCGCTGTCG
CCGGCGGCCAAGGCGTACGCTTCCAAGCAAGCCAAGACGACCGGAAAGAAGAAGCAATTAGCGGATGACTTGTCG
GACGACGACATTGATGCGATGGCTAATGATATCTTGGATTCTCCCGCAGCGCCCACTACCCGGCCATCGCGGCGC
ACGGCAACGGCCAAGAAGAAGACATATGTGATTGATGATGACAGTGACGATTTTGGAGCCGGAGGAGATTCGGAG
GATGATTTCGCAGAGGACAGCGAGCTTGACTTTGAAGTCTCTTTTTTTCTTTGCCTTTCGAGAAAGAGACCCGCC
GTTGAACGTGATTGCGATTACCCGGACCTTAGTTATCGACCGAGACTGGACTGGCCATTATTCAGCACTGTTTGG
TCCCAGGATTTGCGTAGTTCTTTCGTCTCCAAGGCCTATCTTCAGTACCGCCGCATTGGCCATGCCGTGCGCCAA
CAGCTCGAAGATTTCCCGGAGTTTGCCCGACCAGGCGTCGCCAAAGATGACCTGCCGGAGGGGATCCCCAGAGAT
GCTCCCAACGCAGTTTCGCGCCGCCGTTCCAGTCCGCTGCTGCCGGGCGTGCAGCTGAAGGACGTAGTCGAGAAC
GATGGCTCGTCCTCGTCCGTCCTGCTCGTCGACTGGGACGGTGACCATGATCCCATCAATCCGCGCAACTACAGC
CGCGCCACCCGCATCGGCGCAACCCTGATGGTGTCCGCGCTGGGTTTCGCCGTGGGTGCGGCCTCATCCATCGAA
TCTGGCGTGCTTCCCCAGAACGCAGCAGCCTTTAACATTAGCGATGTAGTCGCATCGCTCGCAACAGGCATGTAT
CTGCTTGGCTTCGCAGCAGGCTCGCTCGTCTCCGGACCCCTGTCCGAAATCCTAGGCCGCAATGCCGTCTACACC
GGCTCCCTCACGCTATTCATGATCTTCGTCATGGCCTCAGGATTGGCCCCCAATATCGGCGCACAGCTCGCTTTC
CGCTTCCTGGCTGGCATCTTCGGCTGTCCACCACTGACCTGCGCCGGCGGCACCATCGCCGACCTCTGGAACCCC
TTGGAGAAAACCCTCTTCTTCCCTCTCTACGCCATCCTCTCCTTCGGCGGGCCCGTCCTCGGCCCTGTCATCGCC
TCCTACATGGGCGAGGGCACCCTCTCCTGGCGCTGGACCAACTGGATTATCCTCATTCTGGCAGGCTTCATCCTG
GCTCTGATCCTCCTGCTGCAGCCCGAGACCTACGGCCCCCTACTCCTGAAATGGAAGGCGCACCATCTCCGCCAG
CAAACGGGCGACAATCGCTACCGCTCATCAATGGATCTGCAGGAGACGGCGCTGTTCTCTCGCATCGGAACCGCC
TGCATGCGACAATTCGCCCTGACCATCCACGAACCCATCATCTTGCTAATCTCCCTCTACATGACCGTCATCTAC
ATCGTGCTCTTCACTTTCTTCGACGGATACACGTATATTTTCAGCGACGTGCACGGCCTCTCCCAAGGCCTGACC
AACATCGTCTGGGTTGCCATGTACGTCGGCATCTCAATGGCCGGACTCTTCGTTCCCGTCGTGTACGTCTGGACA
AAGCGCGAATTCTCCGACGCGGCTGCATCCGCTGCTGCATCTGCAGCGGCTTCTCCCCGATCGGCCAGTTCGGAA
ATAGTCACTGCCGATCCCAACGCCAATGGCGCCGATACCTCTGAGAAACCGAACCTCGACGACGATGATACTCAA
AAACCCACCCAGCAACACAAGCACGTCGCTCGTCCCGAGAACCGTCTCTGGTTCGCCATGCTCGGTTCCCCCGCC
ATTCCCATCGGATTATTCTGGATGGGATGGACTGACTACAGCTCAATCTCAATCTGGTCCCCCATCATCGCCTCA
ACCGTTTTCGGCTTCGGCACCATCTGCGTCTTCATCTCCTCATACATGTACGTCATCGACGCATACGACATCTAC
GCCGCCTCTGCGCTGGGCTTCATGACAGTATCGCGCTACTGCGCGGCAGGCGGGATGACGGTCGTGGGGATCCCG
TTTTATAGTAATATGGGGGTGCATTGGACGTTGACGATCTTGGGGGCGATTAGTGCGTTGATGACACCCGTGCCG
TATGTGTTTTATCGCTATGGTGTGGTGATTCGGGGGTGGAGTCGGTATGCGGTTTAG
Transcript >Ani_SJS75_1|g128.t1
ATGGACGATTCGATCATGGACGACTCCGTCTTCGACGACGAAGGAAGCTCCGACTTCGTCCCCGAGCCCGCTCCG
AAGCCCAAGGCCAAGGCAGCCCCCAAGAAGGCAGCTTCTAAGGCAGCGCCTAAGAAGCTCACTCAGACCACCCTC
ACTACGAAGACCACATCCAAGGCGGCTTCGAAAAAACGTGCCAAACCGGACAGCGATGACGACGACATTATGGAC
GACGATGACGATCACATGTCCGACGACTCTGTTCTGTCGCACACCCCTCCCAAGAAGGCTAAGAAGACGGCTGGT
CCCTCCAAGAAGGGCGGCGCTAAGCCCCTCGCGGATGTGGAAAATGAATCATTTGGAAAAGATGATTCCGTAGAG
CCCGGAAAGTCCAACAATGCATCAGAGAAGTACCAGAAGCTTACACAACTTGAACACATCATTAAACGTCCCGAT
ACATATATTGGCTCCGTCGAACGCACGACGCAGCAAATGTGGGTATACAGTTCGGAGTCGGACGGAATGGAGTAC
CGTGAAGTCTCCTATGTGCCCGGTCTCTACAAGATCTTCGATGAAATTGTCGTCAACGCAGCCGATAACAAACAG
AATGACGAGAATATGAGCGAGATCCGCGTGACGGTCGACCGTGAGTCGGGCGTGATCAGTGTCTGGAACAATGGC
CGCGGTATTCCCATCGAAATGCATGCCAAGGAAAAGATCTACGTCCCCGAGTTGATCTTTGGTCATCTCCTCACC
TCCTCCAACTACGATGACACGCAACAGAAGGTCACCGGTGGTCGTAACGGTTTCGGTGCCAAGCTCTGTAACGTT
TTCTCCACTGAGTTCTCCATCGAGACTCAGGACTCGTCTCAGAAGAAGAAATATAGGCAGACATGGACGGAAAAC
ATGACCAAGATTGGCAAGGCCAAGATTACCGAGGCCAAGGGAGAAGACTACACCAAGGTCACGTTCAAGCCAGAC
TACGCCAAATTCGGCATGGACGGCATGGATGATGACTTCGAGGCTCTTGTCAAGCGTCGTGTGTATGACCTGGCA
GGCACTGCAAAGGTGAATGTCAAGCTAAACGGCACTCGCATCCCTATCCGCGGCTTCAAGAAGTACATGGAGATG
TACACCAAGGCTATTCGTAAGGAACGTGGAGACACTGGTCCCGCCCCGAAGGACGAGATTATTACTTGCAGCCCA
GACCCTCGCTGGGAGGTCGGTTTCGCCGTTTCCGATGGCGCTTTCCAACAGGTGTCCTTCGTAAACTCCATTGCG
ACCACCTCTGGTGGTACCCATGTTAACTACATTGCCGATCAGATCTGTAATAGATTGGCTGAGCAAGTGAAAAAG
AAGAATAAAAACGGCGCCACGTTGAAAACAGCCCAGATCCGAAACCACATCTTCATCTTCGTCAACGCACTGATT
GTCAACCCGGCATTCACATCCCAGACCAAAGAACAGCTGACGACTAAGGCTTCCCAATTTGGTAGTAAATGTGTG
CTTGATGAAGACTTCTATAAGAAGGTCCTGAAGACAGCGGTGATGGACAACATCTTGCATTTCGCCCAGCAGAAG
GCCGATCAGATGCTCAAAAAGACGGACGGTGGCCGGCGCTCCCGCATGAACAACCCCAAGTTGACCGATGCCAAC
AAGGCCGGAACCAAGGACGGCCATCACTGCACCCTGATCCTCACAGAAGGTGACTCTGCCAAGGGTCTGGCCATG
GCTGGTCGAGCGGTTGTTGGCCCGGATCTTTTTGGTGTTTTCCCGCTCCGAGGTAAACTGCTCAACGTCCGTGAC
GCTTCCTTCGACCAGATCTCAAAAAATCAGGAAATCCAGAATATCAAGAACTTCTTGGGTCTGCAGCACAAGAAG
GAGTATACCGACACCCGCGGCCTTCGGTACGGTCACTTGATGATCATGACTGATCAGGATCACGACGGTAGTCAC
ATCAAGGGCCTGCTCATCAACTTCCTACAGGCCCAGTTTCCCAGTTTGCTGAAGATTCCCGAGTTCTTGATTGAA
TTCATCACCCCCATTGTAAAGGTGTGGAAGGGTGATCCCAAGAACCCTACCAAACAGCGTTCTTTCTTCACTATG
CCCGAGTACGAGGCATGGGCGGAGGAGCACCAGCATGAGCGTGGTTGGGATCACAAGTACTACAAGGGTTTGGGT
ACCAGTACTACTGAGGATGCCCAGGTCTACTTCCGCGACTTGGACCGTCACCTTAAGGAGTTCCACACCATGCAG
GATAACGAGGCGGAGTTGATCGAGCTGGCTTTCTCGAAGAAGAAGGCTGACGAGCGTAAGGAGTGGCTGCGGCAG
TTCAAGCCCGGAACTTTCTTGGATCATTCCGTCGAGAAGATCACCTACACCGACTTCATCAACAAGGAGCTTATC
CTGTTCAGTATGGCGGACAATGTTCGTTCGATTCCCTCTGTTGTTGACGGTCTGAAGCCTGGTCAGCGTAAGGTT
CTGTACACCTGTTTCCGTCGCAATCTGAAGAAGGACATGAAGGTCGTCGAGTTGGCTGGTCACGTCTCGGGTATG
ACCGCGTACCAGCACGGTGATGTTTCCTTGCAGCAAACCATTGTTGGCCTGGCGCAGACCTTTGTTGGGTCCAAC
AACATCAACTGTCTGGAGCCTAGCGGTAACTTTGGTAGTCGTCTTCAGGGTGGTTCCGACTGCGCCAGTGCGCGT
TATATTTACACGCGGCTGTCCCCGTTCGCGCGCCGCATCTTCCATGCGTCAGACGAGCCTCTACTGACCTACAAC
GTCGACGATGGTAAGACTATCGAGCCTGAGGTCTACATGCCGGTGGTTCCCATGATTCTGATCAACGGTGCGGAC
GGTATCGGTACCGGCTGGAGTTCCTCGATTCCCAACTACAACCCGGAGGACGTCGTGGACAACCTGAAGCGGCTG
ATGAATGGCGAGGAGATCAAACCTATGCAGCCCTGGTTCCGTGGGTTCACAGGTGAGGTCACTTCCATCGGCGGT
GATCGCTTCAAATTCAGCGGTATCATCAAAGAGACTGGTGAGAAGGAAGTAGAGATCACCGAACTGCCCATCCGA
ACTTGGACTCAGGATTTCAAGGATAAGCTTGAAGATATCATCAAGGCGGAAAAGACACCGTCGTTCATCAAGGAC
TACAAGGATTACAACACGCACACCAAGGTTCACTTTGTAATCCAAATGGATGAGAAGCATCTGAAGTCTGCCGTC
GAAGAAGGCTTGGAAGAAAAGTTCAAGCTGACGAAGACCATCGCCACCACGAACTTGGTTGCGTTTGATCCCGAG
GGTCGGATTACCAAATATGCGACAGTGGACGACATTCTGAAGGAATTCTTTGCAGTCCGTCTGAAGTATTACGAG
CGCCGCAAGCAATACCAACTCAACGAAATGCAAAAGGAGCTGGAGAAGCTGAGCAACCAGGCGCGCTTTGTCCAG
ATGATCATCGACGGTGAGCTCGTCGTTTCGAAGAAGAAGAAGAATGTGCTCGTTGTGGAGCTGAAGGACAAGGGC
TTCAAGCCATTCCCCAAGGTGGCGGATGCTGCCAAGGCAGGGGAAGCCGAGCCAGCTGCTGAAGATGAGGAGGAA
TCCGAAGACGTCGATGATACCAGCAATCTTTCCAACGCGTATGACTACCTGCTGGGTATGGCGATCTGGTCGTTG
ACCCAGGAGCGTGTGGAGCGCCTCCGTCGCCAGATTGGTGATAAGGAGATGGAAATTGACACCTTGATCAAGCTT
TCCAAGGAAGATATCTGGAAGCGGGATTTGGATGACTTCATCAACGAATGGCGCTTCCAGCTCGACGATGAAGCT
CGTCGCATGCGTAAGGTGGCAAACATGGGCCGCCGTACCTCCTCCAAGCTGATGACGGCTGTGGGCCGTGGCGGT
GCCCGCAAGCGCAAGGCTGCTAAGGATGATGACTCGGATGATGAAGACTTCGCCGCACCGAAGACCAAGCGCGGT
CCGAAGAAGGCCGAGCCTAAAGGCACGCTCCATAGTTTCTTGAACAAGTCCTCTCCTAAGCCCAAGCCTGCAGCG
GACGACGATGACGACGACGATGATTTTGAAATGGAGGTGATGCCGAAGAAGAATCGCGGGGCCAGCAAGCCGGCA
GCGCCAGCGAAGGAAGAAGAGAAAGAGACAGGCGAATCCGATGTGGAAATCCTGCCGAAGAAGAGTCGGGCTGCA
CCCAAGGCTGCGTCCAAAGTTAAGGCCGAAGATCCCGACAGTACTGAGGTGAAGAAAGCACCAGCTAAACGGGGC
CGTCCGGCGGCCAAAGCGAAGGCCAAGCCAGCGGAAGAGGAGATCGAGCTGGACGACGACGAGTTCATGGAGATC
ACTAAGGCGCAAGCTGCCGAGACTAGCAAGGCTGACCCAGCGCCCAGTCGAGCGCGCAAGCCGGCCAAGTACACC
TTGAGTGACTCGGACAGCGACAACGGGGACGACCTCCTGGGCGACGTGAGCAAAATGGTCAAGGGGATCGGCGGC
ACTACCGGCGGATCGACATCGGACTCCCGGCAGCTGTTCTCGGAGCGCTCTGGGACCGGCAGCACCTCGGGACTG
GCCAGCAGCTCCAAGGCCTCGAAGCAGTCTCCCGATTTTGACGCAGACGAGACTGACTACAGCAAGCTCGTCCCA
CAGAGCTCTCCGCGCCGGTCGCTGCAGGTTAAGTCCAAGGAGACCAAGACGTTAGTTGACAGCGATGAGGAGGAG
GATGAGCCAGTGAAGCCGGCCGCTACCAAGGCCAAGCCGGCGGCCCGAGGCAAGGCAGCGGCAGCCAAACCGGCC
GCGAAGCCACGAGGACGGCCAAAGAAGGATGCCACCACCACGACGGCTGCATCTGCTAAGCAGACGGCGCTGTCG
CCGGCGGCCAAGGCGTACGCTTCCAAGCAAGCCAAGACGACCGGAAAGAAGAAGCAATTAGCGGATGACTTGTCG
GACGACGACATTGATGCGATGGCTAATGATATCTTGGATTCTCCCGCAGCGCCCACTACCCGGCCATCGCGGCGC
ACGGCAACGGCCAAGAAGAAGACATATGTGATTGATGATGACAGTGACGATTTTGGAGCCGGAGGAGATTCGGAG
GATGATTTCGCAGAGGACAGCGAGCTTGACTTTGAAGTCTCTTTTTTTCTTTGCCTTTCGAGAAAGAGACCCGCC
GTTGAACGTGATTGCGATTACCCGGACCTTAGTTATCGACCGAGACTGGACTGGCCATTATTCAGCACTGTTTGG
TCCCAGGATTTGCGTAGTTCTTTCGTCTCCAAGGCCTATCTTCAGTACCGCCGCATTGGCCATGCCGTGCGCCAA
CAGCTCGAAGATTTCCCGGAGTTTGCCCGACCAGGCGTCGCCAAAGATGACCTGCCGGAGGGGATCCCCAGAGAT
GCTCCCAACGCAGTTTCGCGCCGCCGTTCCAGTCCGCTGCTGCCGGGCGTGCAGCTGAAGGACGTAGTCGAGAAC
GATGGCTCGTCCTCGTCCGTCCTGCTCGTCGACTGGGACGGTGACCATGATCCCATCAATCCGCGCAACTACAGC
CGCGCCACCCGCATCGGCGCAACCCTGATGGTGTCCGCGCTGGGTTTCGCCGTGGGTGCGGCCTCATCCATCGAA
TCTGGCGTGCTTCCCCAGAACGCAGCAGCCTTTAACATTAGCGATGTAGTCGCATCGCTCGCAACAGGCATGTAT
CTGCTTGGCTTCGCAGCAGGCTCGCTCGTCTCCGGACCCCTGTCCGAAATCCTAGGCCGCAATGCCGTCTACACC
GGCTCCCTCACGCTATTCATGATCTTCGTCATGGCCTCAGGATTGGCCCCCAATATCGGCGCACAGCTCGCTTTC
CGCTTCCTGGCTGGCATCTTCGGCTGTCCACCACTGACCTGCGCCGGCGGCACCATCGCCGACCTCTGGAACCCC
TTGGAGAAAACCCTCTTCTTCCCTCTCTACGCCATCCTCTCCTTCGGCGGGCCCGTCCTCGGCCCTGTCATCGCC
TCCTACATGGGCGAGGGCACCCTCTCCTGGCGCTGGACCAACTGGATTATCCTCATTCTGGCAGGCTTCATCCTG
GCTCTGATCCTCCTGCTGCAGCCCGAGACCTACGGCCCCCTACTCCTGAAATGGAAGGCGCACCATCTCCGCCAG
CAAACGGGCGACAATCGCTACCGCTCATCAATGGATCTGCAGGAGACGGCGCTGTTCTCTCGCATCGGAACCGCC
TGCATGCGACAATTCGCCCTGACCATCCACGAACCCATCATCTTGCTAATCTCCCTCTACATGACCGTCATCTAC
ATCGTGCTCTTCACTTTCTTCGACGGATACACGTATATTTTCAGCGACGTGCACGGCCTCTCCCAAGGCCTGACC
AACATCGTCTGGGTTGCCATGTACGTCGGCATCTCAATGGCCGGACTCTTCGTTCCCGTCGTGTACGTCTGGACA
AAGCGCGAATTCTCCGACGCGGCTGCATCCGCTGCTGCATCTGCAGCGGCTTCTCCCCGATCGGCCAGTTCGGAA
ATAGTCACTGCCGATCCCAACGCCAATGGCGCCGATACCTCTGAGAAACCGAACCTCGACGACGATGATACTCAA
AAACCCACCCAGCAACACAAGCACGTCGCTCGTCCCGAGAACCGTCTCTGGTTCGCCATGCTCGGTTCCCCCGCC
ATTCCCATCGGATTATTCTGGATGGGATGGACTGACTACAGCTCAATCTCAATCTGGTCCCCCATCATCGCCTCA
ACCGTTTTCGGCTTCGGCACCATCTGCGTCTTCATCTCCTCATACATGTACGTCATCGACGCATACGACATCTAC
GCCGCCTCTGCGCTGGGCTTCATGACAGTATCGCGCTACTGCGCGGCAGGCGGGATGACGGTCGTGGGGATCCCG
TTTTATAGTAATATGGGGGTGCATTGGACGTTGACGATCTTGGGGGCGATTAGTGCGTTGATGACACCCGTGCCG
TATGTGTTTTATCGCTATGGTGTGGTGATTCGGGGGTGGAGTCGGTATGCGGTTTAG
Gene >Ani_SJS75_1|g128.t1
ATGGACGATTCGATCATGGACGACTCCGTCTTCGACGACGAAGGAAGCTCCGACTTCGTCCCCGAGCCCGCTCCG
GTATGTAACCTTCTCATTCTAGCCTCCTGCTTCGGACTCAGCGAGCTCATGATAATTACAGAAGCCCAAGGCCAA
GGCAGCCCCCAAGAAGGCAGCTTCTAAGGCAGCGCCTAAGAAGCTCACTCAGACCACCCTCACTACGAAGACCAC
ATCCAAGGCGGCTTCGAAAAAACGTGCCAAACCGGACAGCGATGACGACGACATTATGGACGACGATGACGATCA
CATGTCCGACGACTCTGTTCTGTCGCACACCCCTCCCAAGAAGGCTAAGAAGACGGCTGGTCCCTCCAAGAAGGG
CGGCGCTAAGCCCCTCGCGGATGTGGAAAATGAATCATTTGGAAAAGATGATTCCGTAGAGCCCGGAAAGTCCAA
CAATGCATCAGAGAAGTACCAGAAGGCAAGTATTTCCGGCGTCGCTGGGCCAAACTTGGGCTAACAGTCGCATTT
ATAGCTTACACAACTTGAACACATCATTAAACGTCCCGATACATATATTGGCTCCGTCGAACGCACGACGCAGCA
AATGTGGGTATACAGTTCGGAGTCGGACGGAATGGAGTACCGTGAAGTCTCCTATGTGCCCGGTCTCTACAAGAT
CTTCGATGAAATTGTCGTCAACGCAGCCGATAACAAACAGAATGACGAGAATATGAGCGAGATCCGCGTGACGGT
CGACCGTGAGTCGGGCGTGATCAGTGTCTGGAACAATGGCCGCGGTATTCCCATCGAAATGCATGCCAAGGAAAA
GATCTACGTCCCCGAGTTGATCTTTGGTCATCTCCTCACCTCCTCCAACTACGATGACACGCAACAGAAGGTCAC
CGGTGGTCGTAACGGTTTCGGTGCCAAGCTCTGTAACGTTTTCTCCACTGAGTTCTCCATCGAGACTCAGGACTC
GTCTCAGAAGAAGAAATATAGGCAGACATGGACGGAAAACATGACCAAGATTGGCAAGGCCAAGATTACCGAGGC
CAAGGGAGAAGACTACACCAAGGTCACGTTCAAGCCAGACTACGCCAAATTCGGCATGGACGGCATGGATGATGA
CTTCGAGGCTCTTGTCAAGCGTCGTGTGTATGACCTGGCAGGCACTGCAAAGGTGAATGTCAAGCTAAACGGCAC
TCGCATCCCTATCCGCGGCTTCAAGAAGTACATGGAGATGTACACCAAGGCTATTCGTAAGGAACGTGGAGACAC
TGGTCCCGCCCCGAAGGACGAGATTATTACTTGCAGCCCAGACCCTCGCTGGGAGGTCGGTTTCGCCGTTTCCGA
TGGCGCTTTCCAACAGGTGTCCTTCGTAAACTCCATTGCGACCACCTCTGGTGGTACCCATGTTAACTACATTGC
CGATCAGATCTGTAATAGATTGGCTGAGCAAGTGAAAAAGAAGAATAAAAACGGCGCCACGTTGAAAACAGCCCA
GATCCGAAACCACATCTTCATCTTCGTCAACGCACTGATTGTCAACCCGGCATTCACATCCCAGACCAAAGAACA
GCTGACGACTAAGGCTTCCCAATTTGGTAGTAAATGTGTGCTTGATGAAGACTTCTATAAGAAGGTCCTGAAGAC
AGCGGTGATGGACAACATCTTGCATTTCGCCCAGCAGAAGGCCGATCAGATGCTCAAAAAGACGGACGGTGGCCG
GCGCTCCCGCATGAACAACCCCAAGTTGACCGATGCCAACAAGGCCGGAACCAAGGACGGCCATCACTGCACCCT
GATCCTCACAGAAGGTGACTCTGCCAAGGGTCTGGCCATGGCTGGTCGAGCGGTTGTTGGCCCGGATCTTTTTGG
TGTTTTCCCGCTCCGAGGTAAACTGCTCAACGTCCGTGACGCTTCCTTCGACCAGATCTCAAAAAATCAGGAAAT
CCAGAATATCAAGAACTTCTTGGGTCTGCAGCACAAGAAGGAGTATACCGACACCCGCGGCCTTCGGTACGGTCA
CTTGATGATCATGACTGATCAGGATCACGACGGTAGTCACATCAAGGGCCTGCTCATCAACTTCCTACAGGCCCA
GTTTCCCAGTTTGCTGAAGATTCCCGAGTTCTTGATTGAATTCATCACCCCCATTGTAAAGGTGTGGAAGGGTGA
TCCCAAGAACCCTACCAAACAGCGTTCTTTCTTCACTATGCCCGAGTACGAGGCATGGGCGGAGGAGCACCAGCA
TGAGCGTGGTTGGGATCACAAGTACTACAAGGGTTTGGGTACCAGTACTACTGAGGATGCCCAGGTCTACTTCCG
CGACTTGGACCGTCACCTTAAGGAGTTCCACACCATGCAGGATAACGAGGCGGAGTTGATCGAGCTGGCTTTCTC
GAAGAAGAAGGCTGACGAGCGTAAGGAGTGGCTGCGGCAGTTCAAGCCCGGAACTTTCTTGGATCATTCCGTCGA
GAAGATCACCTACACCGACTTCATCAACAAGGAGCTTATCCTGTTCAGTATGGCGGACAATGTTCGTTCGATTCC
CTCTGTTGTTGACGGTCTGAAGCCTGGTCAGCGTAAGGTTCTGTACACCTGTTTCCGTCGCAATCTGAAGAAGGA
CATGAAGGTCGTCGAGTTGGCTGGTCACGTCTCGGGTATGACCGCGTACCAGCACGGTGATGTTTCCTTGCAGCA
AACCATTGTTGGCCTGGCGCAGACCTTTGTTGGGTCCAACAACATCAACTGTCTGGAGCCTAGCGGTAACTTTGG
TAGTCGTCTTCAGGGTGGTTCCGACTGCGCCAGTGCGCGTTATATTTACACGCGGCTGTCCCCGTTCGCGCGCCG
CATCTTCCATGCGTCAGACGAGCCTCTACTGACCTACAACGTCGACGATGGTAAGACTATCGAGCCTGAGGTCTA
CATGCCGGTGGTTCCCATGATTCTGATCAACGGTGCGGACGGTATCGGTACCGGCTGGAGTTCCTCGATTCCCAA
CTACAACCCGGAGGACGTCGTGGACAACCTGAAGCGGCTGATGAATGGCGAGGAGATCAAACCTATGCAGCCCTG
GTTCCGTGGGTTCACAGGTGAGGTCACTTCCATCGGCGGTGATCGCTTCAAATTCAGCGGTATCATCAAAGAGAC
TGGTGAGAAGGAAGTAGAGATCACCGAACTGCCCATCCGAACTTGGACTCAGGATTTCAAGGATAAGCTTGAAGA
TATCATCAAGGCGGAAAAGACACCGTCGTTCATCAAGGACTACAAGGATTACAACACGCACACCAAGGTTCACTT
TGTAATCCAAATGGATGAGAAGCATCTGAAGTCTGCCGTCGAAGAAGGCTTGGAAGAAAAGTTCAAGCTGACGAA
GACCATCGCCACCACGAACTTGGTTGCGTTTGATCCCGAGGGTCGGATTACCAAATATGCGACAGTGGACGACAT
TCTGAAGGAATTCTTTGCAGTCCGTCTGAAGTATTACGAGCGCCGCAAGGTAGGCCATTCCCAGACGAACTTGAT
GCTAGTGTGCTGTCTACTAACACCGAAGTTTAGCAATACCAACTCAACGAAATGCAAAAGGAGCTGGAGAAGCTG
AGCAACCAGGCGCGCTTTGTCCAGATGATCATCGACGGTGAGCTCGTCGTTTCGAAGAAGAAGAAGAATGTGCTC
GTTGTGGAGCTGAAGGACAAGGGCTTCAAGCCATTCCCCAAGGTGGCGGATGCTGCCAAGGCAGGGGAAGCCGAG
CCAGCTGCTGAAGATGAGGAGGAATCCGAAGACGTCGATGATACCAGCAATCTTTCCAACGCGTATGACTACCTG
CTGGGTATGGCGATCTGGTCGTTGACCCAGGAGCGTGTGGAGCGCCTCCGTCGCCAGATTGGTGATAAGGAGATG
GAAATTGACACCTTGATCAAGCTTTCCAAGGAAGATATCTGGAAGCGGGATTTGGATGACTTCATCAACGAATGG
CGCTTCCAGCTCGACGATGAAGCTCGTCGCATGCGTAAGGTGGCAAACATGGGCCGCCGTACCTCCTCCAAGCTG
ATGACGGCTGTGGGCCGTGGCGGTGCCCGCAAGCGCAAGGCTGCTAAGGATGATGACTCGGATGATGAAGACTTC
GCCGCACCGAAGACCAAGCGCGGTCCGAAGAAGGCCGAGCCTAAAGGCACGCTCCATAGTTTCTTGAACAAGTCC
TCTCCTAAGCCCAAGCCTGCAGCGGACGACGATGACGACGACGATGATTTTGAAATGGAGGTGATGCCGAAGAAG
AATCGCGGGGCCAGCAAGCCGGCAGCGCCAGCGAAGGAAGAAGAGAAAGAGACAGGCGAATCCGATGTGGAAATC
CTGCCGAAGAAGAGTCGGGCTGCACCCAAGGCTGCGTCCAAAGTTAAGGCCGAAGATCCCGACAGTACTGAGGTG
AAGAAAGCACCAGCTAAACGGGGCCGTCCGGCGGCCAAAGCGAAGGCCAAGCCAGCGGAAGAGGAGATCGAGCTG
GACGACGACGAGTTCATGGAGATCACTAAGGCGCAAGCTGCCGAGACTAGCAAGGCTGACCCAGCGCCCAGTCGA
GCGCGCAAGCCGGCCAAGTACACCTTGAGTGACTCGGACAGCGACAACGGGGACGACCTCCTGGGCGACGTGAGC
AAAATGGTCAAGGGGATCGGCGGCACTACCGGCGGATCGACATCGGACTCCCGGCAGCTGTTCTCGGAGCGCTCT
GGGACCGGCAGCACCTCGGGACTGGCCAGCAGCTCCAAGGCCTCGAAGCAGTCTCCCGATTTTGACGCAGACGAG
ACTGACTACAGCAAGCTCGTCCCACAGAGCTCTCCGCGCCGGTCGCTGCAGGTTAAGTCCAAGGAGACCAAGACG
TTAGTTGACAGCGATGAGGAGGAGGATGAGCCAGTGAAGCCGGCCGCTACCAAGGCCAAGCCGGCGGCCCGAGGC
AAGGCAGCGGCAGCCAAACCGGCCGCGAAGCCACGAGGACGGCCAAAGAAGGATGCCACCACCACGACGGCTGCA
TCTGCTAAGCAGACGGCGCTGTCGCCGGCGGCCAAGGCGTACGCTTCCAAGCAAGCCAAGACGACCGGAAAGAAG
AAGCAATTAGCGGATGACTTGTCGGACGACGACATTGATGCGATGGCTAATGATATCTTGGATTCTCCCGCAGCG
CCCACTACCCGGCCATCGCGGCGCACGGCAACGGCCAAGAAGAAGACATATGTGATTGATGATGACAGTGACGAT
TTTGGAGCCGGAGGAGATTCGGAGGATGATTTCGCAGAGGACAGCGAGTAGAAGAAAGATGTGGCGAGAGGAGTA
CATACATGTGGACGTAACTAATTTTCTATTGAGTCGTTCTGTACCTACTACTACTACTACTATTCCATTGGTATT
ACTTATCGGATGTGATAATACAGTCGGAATTCCATTTGTTAATTTTCAACGTCTTATCTCGGGATGTTTGAGTAG
AAGCAAAGAAAAGTCGGCGAGAAGTCCGAGTGTGTGGCCCCAGGCTCCACTCAGGCTCCACTTGGTGATCCACCA
AATTCAAGGCTTGACTTTGAAGTCTCTTTTTTTCTTTGCCTTTCGAGAAAGAGACCCGCCGTTGAACGTGATTGC
GATTACCCGGACCTTAGTTATCGACCGAGACTGGACTGGCCATTATTCAGCACTGTTTGGTCCCAGGATTTGCGT
AGTTCTTTCGTCTCCAAGGTGGTTCTCTCGTCTGTCCCTCTTCCTTTCCTTCTTCTCTTCCTGTGCCTCTCCCAC
TGACAGACATCTCCCCTCCATGCAGGCCTATCTTCAGTACCGCCGCATTGGCCATGCCGTGCGCCAACAGCTCGA
AGATTTCCCGGAGTTTGCCCGACCAGGCGTCGCCAAAGATGACCTGCCGGAGGGGATCCCCAGAGATGCTCCCAA
CGCAGTTTCGCGCCGCCGTTCCAGTCCGCTGCTGCCGGGCGTGCAGCTGAAGGACGTAGTCGAGAACGATGGCTC
GTCCTCGTCCGTCCTGCTCGTCGACTGGGACGGTGACCATGATCCCATCAATCCGCGCAACTACAGCCGCGCCAC
CCGCATCGGCGCAACCCTGATGGTGTCCGCGCTGGGTTTCGCCGTGGGTGCGGCCTCATCCATCGAATCTGGCGT
GCTTCCCCAGAACGCAGCAGCCTTTAACATTAGCGATGTAGTCGCATCGCTCGCAACAGGCATGTATCTGCTTGG
CTTCGCAGCAGGCTCGCTCGTCTCCGGACCCCTGTCCGAAATCCTAGGCCGCAATGCCGTCTACACCGGCTCCCT
CACGCTATTCATGATCTTCGTCATGGCCTCAGGATTGGCCCCCAATATCGGCGCACAGCTCGCTTTCCGCTTCCT
GGCTGGCATCTTCGGCTGTCCACCACTGACCTGCGCCGGCGGCACCATCGCCGACCTCTGGAACCCCTTGGAGAA
AACCCTCTTCTTCCCTCTCTACGCCATCCTCTCCTTCGGCGGGCCCGTCCTCGGCCCTGTCATCGCCTCCTACAT
GGGCGAGGGCACCCTCTCCTGGCGCTGGACCAACTGGATTATCCTCATTCTGGCAGGCTTCATCCTGGCTCTGAT
CCTCCTGCTGCAGCCCGAGACCTACGGCCCCCTACTCCTGAAATGGAAGGCGCACCATCTCCGCCAGCAAACGGG
CGACAATCGCTACCGCTCATCAATGGATCTGCAGGAGACGGCGCTGTTCTCTCGCATCGGAACCGCCTGCATGCG
ACAATTCGCCCTGACCATCCACGAACCCATCATCTTGCTAATCTCCCTCTACATGACCGTCATCTACATCGTGCT
CTTCACTTTCTTCGACGGATACACGTATATTTTCAGCGACGTGCACGGCCTCTCCCAAGGCCTGACCAACATCGT
CTGGGTTGCCATGTACGTCGGCATCTCAATGGCCGGACTCTTCGTTCCCGTCGTGTACGTCTGGACAAAGCGCGA
ATTCTCCGACGCGGCTGCATCCGCTGCTGCATCTGCAGCGGCTTCTCCCCGATCGGCCAGTTCGGAAATAGTCAC
TGCCGATCCCAACGCCAATGGCGCCGATACCTCTGAGAAACCGAACCTCGACGACGATGATACTCAAAAACCCAC
CCAGCAACACAAGCACGTCGCTCGTCCCGAGAACCGTCTCTGGTTCGCCATGCTCGGTTCCCCCGCCATTCCCAT
CGGATTATTCTGGATGGGATGGACTGACTACGTACACCTCCCCCCCTCTCTCACCCCCAGTTCTGAAATAATACT
AACATGATGAACAAATAGAGCTCAATCTCAATCTGGTCCCCCATCATCGCCTCAACCGTTTTCGGCTTCGGCACC
ATCTGCGTCTTCATCTCCTCATACATGTACGTCATCGACGCATACGACATCTACGCCGCCTCTGCGCTGGGCTTC
ATGACAGTATCGCGCTACTGCGCGGCAGGCGGGATGACGGTCGTGGGGATCCCGTTTTATAGTAATATGGGGGTG
CATTGGACGTTGACGATCTTGGGGGCGATTAGTGCGTTGATGACACCCGTGCCGTATGTGTTTTATCGCTATGGT
GTGGTGATTCGGGGGTGGAGTCGGTATGCGGTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail