Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g9968.t1
Gene name
Locationscaffold_120:3552..7715
Strand+
Gene length (bp)4163
Transcript length (bp)3090
Coding sequence length (bp)3090
Protein length (aa) 1030

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11951 Fungal_trans_2 Fungal specific transcription factor domain 1.1E-37 655 1017
PF07690 MFS_1 Major Facilitator Superfamily 1.1E-29 83 472

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0006810 transport No
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 80 102 22
2 117 139 22
3 152 174 22
4 207 229 22
5 236 255 19
6 309 328 19
7 349 371 22
8 391 413 22
9 420 442 22
10 452 474 22
11 487 509 22

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g9968.t1
MPPPDCSRRQIAPKADGCRADLGNVPITLDELEIDSYFASCPRTEGPSSTQESVIVTWNGEDDPKDPYNWPLSKK
WRATGIGLLASFVCSMNGTILTVAHTAIGDEFHISDATFPNTYWLTTSWGIGAALCPLLLFPVMEDFGVRPVLLT
TYFCFISFLIPVGLAPNFATLIVVRFFSGGCVPLISDAVAGITSNVFHGDRARSVPICLYVTIYLAATSLGPVVG
SAILQFLSWRWIAYIELIWTAALYPILIFGLPESRGPAILRAKAKRLRREGTNAYTTEKIDRVALPQLILQSVQR
PLYMLCTEGVVFVATVWAAFSLGTIYLFTQSVEQVYKELYRWDPIQCGYVQVAIVIGELLGGGFCILTDPWYYAS
ATRNTEAPGTPIPEARLHASIIGGLFGVTSGMFVYGWTSYTSIHWMAPTVGLAMVGFETTAVIVGNANYLIDAYS
KYAASALGAVGFVENISIAFLPLAAAAMYTNIGFQWASSLLAFVSLALVATPFVVLQWGKEIRSYSPFMQEATVE
RRRDCAAAAGNVSEEASLSVETPFAVSGDASPTRAADSPGPETDPRIAALQPHRDNSEDQGQSPCSSTPTDDGQL
QLADGDAFYEWPSQVATTIESSPMAASDLPNTTTSMPPSVLYNNIWQRFGPVLERYNMEFCTIPLTFDLQMNPFR
YRKTIVPEPMFLVHAVMALAGHHVKSPSTDDHRYTALKLLRESINASGNLEDGSSMLDAIMILFSFDETQSTLGY
WSTHLKGAYGIIEACGGIEAWTTSARADAQIGLLLWWDAIISLLSREDCVFPYAYVEAILSNPDDRKWNFFDLCG
CPHSVVTLLMQVVRLSVEKRQSSSMRYVTFDTTMIAQIEQALESWHHISPAALAFGSEEDIQKDQDCIHCSEAWR
HGLLLYIYRVFRWKPGSPIPTHVVRWARVVVDHVVACRDESMVARQALLPLFFAGCEQRDRSVRQKIVQFCSVWN
DRTRYQMFGSTIPLLEEVWAEQEAKGFENVWWGQVVDRKHTVSCYPLQMRLCFG*
Coding >Ani_SJS72_1|g9968.t1
ATGCCACCCCCGGATTGTTCGCGGCGACAGATTGCACCGAAAGCAGATGGCTGTAGAGCCGATCTTGGAAACGTA
CCGATCACACTAGACGAGCTCGAAATCGATTCCTACTTCGCATCGTGCCCTCGTACCGAAGGCCCAAGCTCTACT
CAAGAGAGCGTGATTGTCACGTGGAACGGAGAGGATGACCCCAAAGATCCATACAACTGGCCCCTTTCGAAGAAA
TGGCGCGCCACGGGCATTGGCTTGCTTGCGAGCTTTGTCTGCTCGATGAATGGGACCATCCTAACGGTGGCTCAC
ACGGCCATTGGGGACGAATTTCACATTTCTGATGCGACGTTCCCCAATACCTACTGGCTAACAACATCTTGGGGT
ATCGGGGCCGCGCTTTGCCCGCTTCTTCTGTTTCCTGTAATGGAGGACTTTGGCGTTCGACCTGTCCTTCTGACC
ACCTATTTTTGCTTTATTTCTTTTTTGATTCCTGTGGGGCTGGCACCAAACTTTGCCACCCTGATTGTGGTTCGA
TTCTTCAGCGGGGGATGTGTTCCGCTGATAAGCGACGCCGTTGCCGGTATTACATCGAATGTCTTTCACGGCGAT
CGAGCTCGGAGTGTCCCAATTTGTCTGTACGTGACCATCTATCTGGCGGCGACAAGTCTGGGCCCGGTGGTTGGC
TCTGCCATCCTGCAATTCCTGTCATGGCGCTGGATTGCGTACATCGAACTGATCTGGACCGCTGCCCTATATCCG
ATTCTGATCTTCGGTCTGCCAGAGAGCCGCGGGCCGGCGATCTTGCGCGCTAAGGCCAAACGACTGCGCCGCGAG
GGGACGAACGCGTACACGACCGAGAAGATCGATCGGGTAGCATTGCCTCAGCTTATCCTGCAGAGCGTTCAACGG
CCTCTGTACATGCTATGTACTGAAGGGGTCGTGTTCGTTGCGACGGTGTGGGCTGCCTTCAGCTTGGGAACAATC
TATCTTTTTACGCAATCAGTCGAGCAGGTATACAAGGAGCTATATAGGTGGGATCCCATCCAGTGTGGATATGTC
CAAGTTGCGATTGTGATCGGGGAACTTCTGGGCGGTGGATTTTGCATCTTAACCGATCCCTGGTACTATGCATCT
GCGACCCGCAATACCGAGGCACCGGGCACGCCGATCCCGGAGGCTCGGCTTCATGCATCGATTATTGGTGGACTC
TTTGGTGTCACGAGCGGCATGTTCGTGTATGGGTGGACATCGTACACTTCCATACACTGGATGGCACCCACCGTC
GGCCTGGCGATGGTGGGGTTTGAGACGACGGCGGTCATCGTTGGCAATGCCAACTATCTCATCGACGCGTACAGC
AAGTATGCTGCGAGCGCCCTCGGGGCGGTGGGTTTCGTCGAGAACATCTCTATCGCCTTTCTCCCTCTGGCCGCA
GCAGCCATGTACACGAATATCGGGTTTCAGTGGGCCAGCTCGCTGCTTGCATTTGTGTCCTTGGCCCTGGTGGCG
ACTCCTTTTGTGGTCCTCCAATGGGGCAAAGAAATCAGATCTTACAGCCCATTCATGCAGGAGGCCACTGTAGAG
CGGAGGAGAGACTGTGCCGCGGCCGCAGGCAACGTTTCCGAGGAAGCCAGCCTCTCCGTAGAGACGCCATTCGCG
GTCTCGGGTGATGCATCGCCAACGAGAGCTGCTGATTCTCCCGGCCCCGAGACCGATCCTAGGATAGCTGCATTA
CAACCGCATCGCGATAACAGCGAAGACCAAGGCCAATCCCCGTGTTCATCTACACCGACAGACGACGGACAGCTA
CAATTAGCTGACGGAGACGCCTTCTATGAATGGCCGAGTCAAGTCGCTACTACTATAGAGTCAAGTCCCATGGCA
GCTTCAGACCTCCCCAACACTACTACATCTATGCCACCGAGCGTACTGTACAATAACATCTGGCAGCGGTTTGGG
CCTGTCCTTGAGAGATACAATATGGAATTCTGCACGATCCCATTAACGTTTGACTTACAGATGAATCCCTTTCGA
TACCGCAAAACCATCGTTCCGGAACCTATGTTTCTGGTCCATGCGGTGATGGCTTTAGCGGGTCATCATGTTAAG
AGCCCATCAACCGATGACCATCGCTATACAGCCTTGAAACTCCTCCGCGAGAGCATCAACGCATCCGGTAATCTG
GAAGATGGCTCCTCCATGCTTGATGCGATTATGATCTTATTTTCCTTCGATGAAACTCAATCCACCCTTGGATAC
TGGAGTACACATCTCAAGGGAGCCTATGGCATCATCGAAGCGTGCGGGGGAATTGAAGCATGGACTACGTCCGCT
CGGGCAGACGCTCAAATAGGATTGCTGTTGTGGTGGGATGCCATCATCAGTCTCTTATCCCGGGAAGACTGCGTG
TTCCCGTACGCATATGTCGAAGCCATCCTATCGAACCCCGATGATCGGAAGTGGAATTTCTTTGACCTCTGCGGG
TGCCCACACAGCGTGGTCACGCTACTCATGCAAGTTGTGCGTCTGAGTGTCGAAAAACGCCAATCGTCGTCCATG
CGGTACGTGACCTTCGACACCACGATGATTGCCCAAATCGAGCAAGCGCTCGAGTCCTGGCATCACATCTCCCCT
GCCGCACTTGCCTTCGGTAGCGAAGAGGACATCCAAAAAGACCAAGATTGTATACACTGCTCGGAGGCATGGAGA
CACGGCCTGCTTCTCTACATATACCGCGTATTCCGATGGAAGCCGGGAAGCCCGATTCCAACGCATGTTGTCCGT
TGGGCCCGGGTTGTTGTGGACCATGTGGTAGCGTGTCGCGACGAGAGCATGGTCGCCCGGCAGGCGTTGCTGCCG
CTCTTCTTCGCGGGCTGCGAACAACGCGATCGATCGGTACGGCAGAAGATCGTGCAGTTTTGCTCGGTGTGGAAT
GACCGAACGCGGTATCAGATGTTCGGGAGCACCATTCCATTGCTTGAAGAAGTATGGGCGGAGCAGGAGGCGAAG
GGATTTGAGAACGTGTGGTGGGGTCAGGTCGTGGATCGAAAACACACCGTGTCTTGTTATCCGTTGCAAATGCGG
CTTTGCTTTGGATGA
Transcript >Ani_SJS72_1|g9968.t1
ATGCCACCCCCGGATTGTTCGCGGCGACAGATTGCACCGAAAGCAGATGGCTGTAGAGCCGATCTTGGAAACGTA
CCGATCACACTAGACGAGCTCGAAATCGATTCCTACTTCGCATCGTGCCCTCGTACCGAAGGCCCAAGCTCTACT
CAAGAGAGCGTGATTGTCACGTGGAACGGAGAGGATGACCCCAAAGATCCATACAACTGGCCCCTTTCGAAGAAA
TGGCGCGCCACGGGCATTGGCTTGCTTGCGAGCTTTGTCTGCTCGATGAATGGGACCATCCTAACGGTGGCTCAC
ACGGCCATTGGGGACGAATTTCACATTTCTGATGCGACGTTCCCCAATACCTACTGGCTAACAACATCTTGGGGT
ATCGGGGCCGCGCTTTGCCCGCTTCTTCTGTTTCCTGTAATGGAGGACTTTGGCGTTCGACCTGTCCTTCTGACC
ACCTATTTTTGCTTTATTTCTTTTTTGATTCCTGTGGGGCTGGCACCAAACTTTGCCACCCTGATTGTGGTTCGA
TTCTTCAGCGGGGGATGTGTTCCGCTGATAAGCGACGCCGTTGCCGGTATTACATCGAATGTCTTTCACGGCGAT
CGAGCTCGGAGTGTCCCAATTTGTCTGTACGTGACCATCTATCTGGCGGCGACAAGTCTGGGCCCGGTGGTTGGC
TCTGCCATCCTGCAATTCCTGTCATGGCGCTGGATTGCGTACATCGAACTGATCTGGACCGCTGCCCTATATCCG
ATTCTGATCTTCGGTCTGCCAGAGAGCCGCGGGCCGGCGATCTTGCGCGCTAAGGCCAAACGACTGCGCCGCGAG
GGGACGAACGCGTACACGACCGAGAAGATCGATCGGGTAGCATTGCCTCAGCTTATCCTGCAGAGCGTTCAACGG
CCTCTGTACATGCTATGTACTGAAGGGGTCGTGTTCGTTGCGACGGTGTGGGCTGCCTTCAGCTTGGGAACAATC
TATCTTTTTACGCAATCAGTCGAGCAGGTATACAAGGAGCTATATAGGTGGGATCCCATCCAGTGTGGATATGTC
CAAGTTGCGATTGTGATCGGGGAACTTCTGGGCGGTGGATTTTGCATCTTAACCGATCCCTGGTACTATGCATCT
GCGACCCGCAATACCGAGGCACCGGGCACGCCGATCCCGGAGGCTCGGCTTCATGCATCGATTATTGGTGGACTC
TTTGGTGTCACGAGCGGCATGTTCGTGTATGGGTGGACATCGTACACTTCCATACACTGGATGGCACCCACCGTC
GGCCTGGCGATGGTGGGGTTTGAGACGACGGCGGTCATCGTTGGCAATGCCAACTATCTCATCGACGCGTACAGC
AAGTATGCTGCGAGCGCCCTCGGGGCGGTGGGTTTCGTCGAGAACATCTCTATCGCCTTTCTCCCTCTGGCCGCA
GCAGCCATGTACACGAATATCGGGTTTCAGTGGGCCAGCTCGCTGCTTGCATTTGTGTCCTTGGCCCTGGTGGCG
ACTCCTTTTGTGGTCCTCCAATGGGGCAAAGAAATCAGATCTTACAGCCCATTCATGCAGGAGGCCACTGTAGAG
CGGAGGAGAGACTGTGCCGCGGCCGCAGGCAACGTTTCCGAGGAAGCCAGCCTCTCCGTAGAGACGCCATTCGCG
GTCTCGGGTGATGCATCGCCAACGAGAGCTGCTGATTCTCCCGGCCCCGAGACCGATCCTAGGATAGCTGCATTA
CAACCGCATCGCGATAACAGCGAAGACCAAGGCCAATCCCCGTGTTCATCTACACCGACAGACGACGGACAGCTA
CAATTAGCTGACGGAGACGCCTTCTATGAATGGCCGAGTCAAGTCGCTACTACTATAGAGTCAAGTCCCATGGCA
GCTTCAGACCTCCCCAACACTACTACATCTATGCCACCGAGCGTACTGTACAATAACATCTGGCAGCGGTTTGGG
CCTGTCCTTGAGAGATACAATATGGAATTCTGCACGATCCCATTAACGTTTGACTTACAGATGAATCCCTTTCGA
TACCGCAAAACCATCGTTCCGGAACCTATGTTTCTGGTCCATGCGGTGATGGCTTTAGCGGGTCATCATGTTAAG
AGCCCATCAACCGATGACCATCGCTATACAGCCTTGAAACTCCTCCGCGAGAGCATCAACGCATCCGGTAATCTG
GAAGATGGCTCCTCCATGCTTGATGCGATTATGATCTTATTTTCCTTCGATGAAACTCAATCCACCCTTGGATAC
TGGAGTACACATCTCAAGGGAGCCTATGGCATCATCGAAGCGTGCGGGGGAATTGAAGCATGGACTACGTCCGCT
CGGGCAGACGCTCAAATAGGATTGCTGTTGTGGTGGGATGCCATCATCAGTCTCTTATCCCGGGAAGACTGCGTG
TTCCCGTACGCATATGTCGAAGCCATCCTATCGAACCCCGATGATCGGAAGTGGAATTTCTTTGACCTCTGCGGG
TGCCCACACAGCGTGGTCACGCTACTCATGCAAGTTGTGCGTCTGAGTGTCGAAAAACGCCAATCGTCGTCCATG
CGGTACGTGACCTTCGACACCACGATGATTGCCCAAATCGAGCAAGCGCTCGAGTCCTGGCATCACATCTCCCCT
GCCGCACTTGCCTTCGGTAGCGAAGAGGACATCCAAAAAGACCAAGATTGTATACACTGCTCGGAGGCATGGAGA
CACGGCCTGCTTCTCTACATATACCGCGTATTCCGATGGAAGCCGGGAAGCCCGATTCCAACGCATGTTGTCCGT
TGGGCCCGGGTTGTTGTGGACCATGTGGTAGCGTGTCGCGACGAGAGCATGGTCGCCCGGCAGGCGTTGCTGCCG
CTCTTCTTCGCGGGCTGCGAACAACGCGATCGATCGGTACGGCAGAAGATCGTGCAGTTTTGCTCGGTGTGGAAT
GACCGAACGCGGTATCAGATGTTCGGGAGCACCATTCCATTGCTTGAAGAAGTATGGGCGGAGCAGGAGGCGAAG
GGATTTGAGAACGTGTGGTGGGGTCAGGTCGTGGATCGAAAACACACCGTGTCTTGTTATCCGTTGCAAATGCGG
CTTTGCTTTGGATGA
Gene >Ani_SJS72_1|g9968.t1
ATGCCACCCCCGGATTGTTCGCGGCGACAGATTGCACCGAAAGCAGATGGCTGTAGAGCCGATCTTGGAAACGTA
CCGATCACACTAGACGAGCTCGAAATCGATTCCTACTTCGCATCGTGCCCTCGTACCGAAGGTTGATATGCATAT
GTCCTTGAACCTATTAACTGAGACCTATCCACTCACTCATCATGACACACAGGCCCAAGCTCTACTCAAGAGAGC
GTGATTGTCACGTGGAACGGAGAGGATGACCCCAAAGATCCATACAACTGGCCCCTTTCGAAGAAATGGCGCGCC
ACGGGCATTGGCTTGCTTGCGAGCTTTGTCTGCTCGATGAATGGGACCATCCTAACGGTGGCTCACACGGCCATT
GGGGACGAATTTCACATTTCTGATGCGACGTTCCCCAATACCTACTGGCTAACAACATCTTGGGGTATCGGGGCC
GCGCTTTGCCCGCTTCTTCTGTTTCCTGTAATGGAGGACTTTGGCGTTCGACCTGTCCTTCTGACCACCTATTTT
TGCTTTATTTCTTTTTTGATTCCTGTGGGGCTGGCACCAAACTTTGCCACCCTGATTGTGGTTCGATTCTTCAGC
GGGGGATGTGTTCCGCTGATAAGCGACGCCGTTGCCGGTATTACATCGAATGTCTTTCACGGCGATCGAGCTCGG
AGTGTCCCAATTTGTCTGTACGTGACCATCTATCTGGCGGCGACAAGTCTGGGCCCGGTGGTTGGCTCTGCCATC
CTGCAATTCCTGTCATGGCGCTGGATTGCGTACATCGAACTGATCTGGACCGCTGCCCTATATCCGATTCTGATC
TTCGGTCTGCCAGAGAGCCGCGGGCCGGCGATCTTGCGCGCTAAGGCCAAACGACTGCGCCGCGAGGGGACGAAC
GCGTACACGACCGAGAAGATCGATCGGGTAGCATTGCCTCAGCTTATCCTGCAGAGCGTTCAACGGCCTCTGTAC
ATGCTATGTACTGAAGGGGTCGTGTTCGTTGCGACGGTGTGGGCTGCCTTCAGCTTGGGAACAATCTATCTTTTT
ACGCAATCAGTCGAGCAGGTATACAAGGAGCTATATAGGTGGGATCCCATCCAGTGTGGATATGTCCAAGTTGCG
ATTGTGATCGGGGAACTTCTGGGCGGTGGATTTTGCATCTTAACCGATCCCTGGTACTATGCATCTGCGACCCGC
AATACCGAGGCACCGGGCACGCCGATCCCGGAGGCTCGGCTTCATGCATCGATTATTGGTGGACTCTTTGGTGTC
ACGAGCGGCATGTTCGTGTATGGGTGGACATCGTACACTTCCATACACTGGATGGCACCCACCGTCGGCCTGGCG
ATGGTGGGGTTTGAGACGACGGCGGTCATCGTTGGCAATGCCAACTATCTCATCGACGCGTACAGCAAGTATGCT
GCGAGCGCCCTCGGGGCGGTGGGTTTCGTCGAGAACATCTCTATCGCCTTTCTCCCTCTGGCCGCAGCAGCCATG
TACACGAATATCGGGTTTCAGTGGGCCAGCTCGCTGCTTGCATTTGTGTCCTTGGCCCTGGTGGCGACTCCTTTT
GTGGTCCTCCAATGGGGCAAAGAAATCAGATCTTACAGCCCATTCATGCAGGAGGCCACTGTAGAGCGGAGGAGA
GACTGTGCCGCGGCCGCAGGTGTATAGACAGCAAGGGCCTTCAGGTGCTGTCCTCTGCGCAGCGCCCCCTCTTAG
ATTAATAAACATTAGATTACGTGAATCTTTCTAAAGATTCCTATGATATGAATAATTGTCGGACTAAACTGGCTA
GTTAGCCGGAGTTGGCCAGTTAACCGATAGATAGATGTATATTTATACATTTATTGTTCAGGTCTAGCTAGCTAG
TCAACTACTATATTTATATAGCTACTATAAATTAGAGTGGCTTATACCTGACTATTATACCTTAACTTGTAACCT
GACTGTTAACTGGTGGTCAGATTAAGATCTAAAATTTCTTTAAACTGTATAATTAAGATCAGGTTGAGATTAAAA
AAGTGGTTGATTACATTAAAATACTAACTATACTCTTACTAAGCCTAAACCCGGTGCCTAATTACCTGATCTCTC
TGCTCGCAACCGTCCCTCATAGGATGCCCCTTTTCACAAGGTATCCGTCAATGCTCGATGCGAACATTGCGAACA
ATCAGGCCATACCCTACTTGGTATCTACGGAACGCTCAAAATGCAGCTATCCTGGAAGCCCGGATATTCTCTCTC
CAATAGGCCCGTGAAAAGGTCAGCAGCCCGTAGGACCAATCGGGGTCGGTTGGGAAACGCAGATGGACCTCAGCA
ATTTGTGTTCGTTGCAGAACATCCTATGAGAGATAGTAAGGCCATACATTTTCAACCAGCCAACATTTATCCACC
CTCCGGAGCGCCCGTTGAACGTATTAAACACTAATAGTAATCTACGGTTGTTGGCTAACAAGAACCTCGTTCTCA
AGGCAACGTTTCCGAGGAAGCCAGCCTCTCCGTAGAGACGCCATTCGCGGTCTCGGGTGATGCATCGCCAACGAG
AGCTGCTGATTCTCCCGGCCCCGAGACCGATCCTAGGATAGCTGCATTACAACCGCATCGCGATAACAGCGAAGA
CCAAGGCCAATCCCCGTGTTCATCTACACCGACAGACGACGGACAGCTACAATTAGCTGACGGAGACGCCTTCTA
TGAATGGCCGAGTCAAGTCGCTACTACTATAGAGTCAAGTCCCATGGCAGCTTCAGACCTCCCCAACACTACTAC
ATCTATGCCACCGAGCGTACTGTACAATAACATCTGGCAGCGGTTTGGGCCTGTCCTTGAGAGATGTTCGCTTAT
TCTGCTCCCAGCTGCTCCTGTCAATGCCCACTAACAGGTCATAGACAATATGGAATTCTGCACGATCCCATTAAC
GTTTGACTTACAGATGAATCCCTTTCGATACCGCAAAACCATCGTTCCGGAACCTATGTTTCTGGTCCATGCGGT
GATGGCTTTAGCGGGTCATCATGTTAAGAGCCCATCAACCGATGACCATCGCTATACAGCCTTGAAACTCCTCCG
CGAGAGCATCAACGCATCCGGTAATCTGGAAGATGGCTCCTCCATGCTTGATGCGATTATGATCTTATTTTCCTT
CGATGTTAGTTTGCACCTTTATCTCTGTTGCTCGGACCTGATCCAAGTTGATAACGAAAGTTAGGAAACTCAATC
CACCCTTGGATACTGGAGTACACATCTCAAGGGAGCCTATGGCATCATCGAAGCGTGCGGGGGAATTGAAGCATG
GACTACGTCCGCTCGGGCAGACGCTCAAATAGGATTGCTGTTGTGGTATATAATCCCCCACCCCCCTCTCCTTCC
CCCAATCAGTCATTTTACGCAAAATCAGCCCGGCACTTCCAGCTAAACTATTTAGGTGGGATGCCATCATCAGTC
TCTTATCCCGGGAAGACTGCGTGTTCCCGTACGCATATGTCGAAGCCATCCTATCGAACCCCGATGATCGGAAGT
GGAATTTCTTTGACCTCTGCGGGTGCCCACACAGCGTGGTCACGCTACTCATGCAAGTTGTGCGTCTGAGTGTCG
AAAAACGCCAATCGTCGTCCATGCGGTACGTGACCTTCGACACCACGATGATTGCCCAAATCGAGCAAGCGCTCG
AGTCCTGGCATCACATCTCCCCTGCCGCACTTGCCTTCGGTAGCGAAGAGGACATCCAAAAAGACCAAGATTGTA
TACACTGCTCGGAGGCATGGAGACACGGCCTGCTTCTCTACATATACCGCGTATTCCGATGGAAGCCGGGAAGCC
CGATTCCAACGCATGTTGTCCGTTGGGCCCGGGTTGTTGTGGACCATGTGGTAGCGTGTCGCGACGAGAGCATGG
TCGCCCGGCAGGCGTTGCTGCCGCTCTTCTTCGCGGGCTGCGAACAACGCGATCGATCGGTACGGCAGAAGATCG
TGCAGTTTTGCTCGGTGTGGAATGACCGAACGCGGTATCAGATGTTCGGGAGCACCATTCCATTGCTTGAAGAAG
TATGGGCGGAGCAGGAGGCGAAGGGATTTGAGAACGTGTGGTGGGGTCAGGTCGTGGATCGAAAACACACCGTGT
CTTGTTATCCGTTGCAAATGCGGCTTTGCTTTGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail