Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g969.t1
Gene name
Locationscaffold_004:459371..462213
Strand+
Gene length (bp)2842
Transcript length (bp)2667
Coding sequence length (bp)2667
Protein length (aa) 889

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.4E-09 413 761

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0006810 transport No
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 12 34 22
2 44 66 22
3 87 109 22
4 119 141 22
5 200 222 22
6 249 271 22
7 407 429 22
8 444 466 22
9 473 495 22
10 573 595 22
11 616 638 22
12 668 687 19
13 692 709 17
14 719 741 22
15 748 770 22
16 775 797 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g969.t1
MQDQRPEVLTVSIVFFVIATVFVALRFISRIFIVQKVALHDYLMLLAWVLDFGFSFSLFYATHKGLGLHDTDIRE
DQRAGLNRADYAFTVLYNPALMAVKTSILVFYLTLTQGEKVFRLANYVTLFVVNAAGLALTLVNVFQCRPVSAAV
SYPFPEGAKCIDILTLYLSSSPVNIVTDLAILFLPNPILTQMRLPRKQKIILVITFSFGFFVAVVDVIRIAYIQD
AATSRQIALREVHLQDTPGDDLSWYGAFSFMWSVIEVNVSVICACVPSLKPLVARLIPKLIRDTDGSSQATDLPL
PAPDPPPEIPTVTGPPTARRASRSPQSASQDNKPSHSESHSSHAASARVDLSDMLTSAPEAPPDVENRTNTVTTT
TSYPPSITFFDFVNMKKPANMLKLSNKESIAPIALTTILFFLWGFAYGLLAILNEQIQDILGLDVWQSFGLHAVY
FGGYLVAPAFVGGVVLKRWGFKCTFITGLCIYACGTLVFWPSAVLTSYPGFIVSNFIVGSGLAVLETAANPFIAL
CGPLENSEIRLNISQGVQAIGSVVSQLLAKKVLFKSVTDVSTLVDVQWTYLGIALFDVLLALAFYYLPIPEASDE
DLEELANRRRADNRATVAGIPVVWLTLGLGVWSQFFYVAGQEVISMSFDSYVRTVHPLSYLSPFEQLTVAHTVFA
VGRFLAAFVQWFLKPRWILMLSYIGMIVFSVLCMKMTGRAAEAMALMVYLFESGVFSIIFAISLRGTGRHTKTAT
VLLTVAIGGGAFFPFAQYAAELAGGIRYSYCVLVALFSAGAIFPIYLNVVPAAKKQVDPVPNEHLRHPRRRSRIK
ANVMAREKENPSVGGVLSRRRSVVSEPLPTVQLADHTKQTSGGLMHELAPWPEQRGERAVQTD*
Coding >Ani_SJS72_1|g969.t1
ATGCAAGACCAACGGCCCGAGGTTCTCACCGTCTCCATTGTCTTCTTCGTCATCGCAACTGTCTTCGTGGCCCTG
CGCTTCATCTCCCGCATCTTTATTGTCCAGAAGGTCGCCCTCCATGATTATTTGATGCTCCTGGCCTGGGTCCTC
GACTTCGGCTTTTCCTTCTCCCTCTTCTACGCCACCCACAAAGGTCTGGGTCTCCACGATACCGACATTCGCGAA
GACCAACGCGCCGGCCTCAATCGCGCCGACTATGCCTTCACCGTCCTCTACAACCCGGCCCTCATGGCCGTCAAA
ACCTCCATTCTGGTCTTCTACCTAACCCTCACCCAAGGCGAGAAGGTCTTTCGCTTGGCCAACTACGTGACTCTC
TTCGTCGTCAATGCCGCCGGACTCGCCTTGACCCTCGTGAATGTCTTCCAATGCCGTCCCGTCAGCGCGGCCGTT
TCCTATCCCTTTCCCGAGGGTGCCAAGTGCATCGACATCCTGACCCTATACCTATCCTCGTCGCCCGTCAACATT
GTGACCGACTTGGCCATTCTCTTCCTGCCCAATCCCATCCTGACGCAAATGCGACTGCCGCGCAAGCAAAAGATC
ATCCTCGTCATCACCTTCAGTTTTGGTTTCTTTGTCGCCGTCGTCGATGTCATCCGCATTGCCTACATCCAGGAT
GCGGCCACCTCCCGTCAGATCGCGTTGAGAGAGGTCCATCTGCAGGATACCCCGGGTGATGACCTCAGCTGGTAC
GGGGCGTTTTCATTTATGTGGTCCGTCATCGAAGTCAACGTTTCCGTCATCTGTGCCTGTGTGCCCAGTCTCAAG
CCGCTTGTCGCGCGACTCATCCCGAAGCTGATCCGTGACACTGACGGGAGCTCCCAGGCCACCGACCTTCCCCTG
CCCGCTCCCGATCCACCCCCTGAGATTCCGACCGTCACCGGGCCTCCTACTGCCCGGCGCGCGTCGCGCTCACCA
CAGTCCGCCAGCCAGGACAATAAGCCGTCGCATTCGGAGAGCCACAGCAGTCATGCGGCCTCGGCCCGGGTTGAC
CTCTCCGATATGTTGACCAGCGCGCCCGAGGCGCCTCCGGATGTCGAGAACCGGACGAACACCGTCACCACAACC
ACGTCGTATCCGCCCAGCATCACCTTCTTCGACTTCGTCAATATGAAGAAGCCGGCCAACATGCTGAAGCTGAGC
AATAAGGAGTCCATTGCCCCGATCGCGCTGACCACCATCTTGTTCTTCCTCTGGGGCTTTGCATACGGCTTGCTG
GCTATCCTGAACGAGCAGATTCAGGATATCCTGGGCCTGGACGTCTGGCAGTCATTTGGTCTGCATGCGGTGTAC
TTTGGGGGGTATCTGGTGGCGCCAGCGTTTGTGGGGGGCGTCGTGCTGAAGCGCTGGGGGTTCAAGTGCACCTTT
ATCACTGGGCTGTGCATTTATGCCTGCGGCACTCTGGTCTTCTGGCCGTCAGCCGTGCTGACTTCGTACCCTGGT
TTCATCGTGTCCAATTTCATTGTGGGCAGTGGACTGGCGGTGCTGGAGACGGCCGCCAATCCGTTCATTGCGCTA
TGCGGACCACTCGAAAACTCGGAGATTCGGCTGAACATCTCGCAGGGCGTGCAGGCAATTGGCAGCGTCGTCTCG
CAGCTACTGGCCAAGAAGGTGCTGTTCAAATCTGTGACCGATGTGAGTACTCTGGTCGATGTGCAGTGGACATAT
TTGGGCATCGCACTGTTCGACGTACTCCTCGCTCTCGCTTTCTATTATCTGCCTATCCCCGAGGCATCGGACGAG
GATCTGGAGGAACTGGCCAACCGCCGCCGCGCCGACAACCGCGCCACCGTCGCTGGCATCCCCGTGGTTTGGCTG
ACACTGGGCCTCGGCGTCTGGTCTCAGTTTTTCTACGTGGCCGGCCAAGAAGTGATATCGATGAGCTTCGACAGC
TATGTCCGCACCGTGCACCCACTGTCCTATCTCAGTCCCTTTGAACAGCTCACGGTCGCACACACGGTGTTCGCG
GTCGGCCGCTTCCTCGCCGCCTTCGTCCAATGGTTCCTCAAACCCCGCTGGATACTTATGCTCTCTTACATCGGC
ATGATCGTCTTCTCCGTCCTGTGCATGAAAATGACCGGACGAGCCGCTGAAGCCATGGCTCTCATGGTGTACCTG
TTCGAGAGCGGCGTATTCAGTATCATTTTTGCCATCTCGCTGCGCGGCACCGGTCGACACACCAAGACCGCGACC
GTACTGCTCACGGTGGCCATCGGCGGCGGCGCCTTCTTCCCATTCGCGCAATACGCAGCCGAGCTGGCAGGCGGC
ATCCGCTATTCCTACTGCGTGCTGGTGGCGCTGTTCAGTGCGGGCGCCATCTTCCCCATCTACCTCAACGTAGTG
CCGGCAGCCAAGAAGCAGGTGGACCCGGTACCGAACGAGCACCTGCGACATCCCCGCCGGCGCAGTCGCATCAAA
GCCAACGTGATGGCGCGCGAAAAGGAGAACCCATCGGTGGGTGGGGTGCTCTCGCGCCGGCGCAGCGTAGTGTCG
GAGCCGTTGCCGACGGTGCAGCTGGCGGACCACACGAAGCAGACGTCGGGGGGATTGATGCATGAATTGGCGCCA
TGGCCAGAGCAGCGCGGGGAGCGTGCGGTGCAGACAGATTAA
Transcript >Ani_SJS72_1|g969.t1
ATGCAAGACCAACGGCCCGAGGTTCTCACCGTCTCCATTGTCTTCTTCGTCATCGCAACTGTCTTCGTGGCCCTG
CGCTTCATCTCCCGCATCTTTATTGTCCAGAAGGTCGCCCTCCATGATTATTTGATGCTCCTGGCCTGGGTCCTC
GACTTCGGCTTTTCCTTCTCCCTCTTCTACGCCACCCACAAAGGTCTGGGTCTCCACGATACCGACATTCGCGAA
GACCAACGCGCCGGCCTCAATCGCGCCGACTATGCCTTCACCGTCCTCTACAACCCGGCCCTCATGGCCGTCAAA
ACCTCCATTCTGGTCTTCTACCTAACCCTCACCCAAGGCGAGAAGGTCTTTCGCTTGGCCAACTACGTGACTCTC
TTCGTCGTCAATGCCGCCGGACTCGCCTTGACCCTCGTGAATGTCTTCCAATGCCGTCCCGTCAGCGCGGCCGTT
TCCTATCCCTTTCCCGAGGGTGCCAAGTGCATCGACATCCTGACCCTATACCTATCCTCGTCGCCCGTCAACATT
GTGACCGACTTGGCCATTCTCTTCCTGCCCAATCCCATCCTGACGCAAATGCGACTGCCGCGCAAGCAAAAGATC
ATCCTCGTCATCACCTTCAGTTTTGGTTTCTTTGTCGCCGTCGTCGATGTCATCCGCATTGCCTACATCCAGGAT
GCGGCCACCTCCCGTCAGATCGCGTTGAGAGAGGTCCATCTGCAGGATACCCCGGGTGATGACCTCAGCTGGTAC
GGGGCGTTTTCATTTATGTGGTCCGTCATCGAAGTCAACGTTTCCGTCATCTGTGCCTGTGTGCCCAGTCTCAAG
CCGCTTGTCGCGCGACTCATCCCGAAGCTGATCCGTGACACTGACGGGAGCTCCCAGGCCACCGACCTTCCCCTG
CCCGCTCCCGATCCACCCCCTGAGATTCCGACCGTCACCGGGCCTCCTACTGCCCGGCGCGCGTCGCGCTCACCA
CAGTCCGCCAGCCAGGACAATAAGCCGTCGCATTCGGAGAGCCACAGCAGTCATGCGGCCTCGGCCCGGGTTGAC
CTCTCCGATATGTTGACCAGCGCGCCCGAGGCGCCTCCGGATGTCGAGAACCGGACGAACACCGTCACCACAACC
ACGTCGTATCCGCCCAGCATCACCTTCTTCGACTTCGTCAATATGAAGAAGCCGGCCAACATGCTGAAGCTGAGC
AATAAGGAGTCCATTGCCCCGATCGCGCTGACCACCATCTTGTTCTTCCTCTGGGGCTTTGCATACGGCTTGCTG
GCTATCCTGAACGAGCAGATTCAGGATATCCTGGGCCTGGACGTCTGGCAGTCATTTGGTCTGCATGCGGTGTAC
TTTGGGGGGTATCTGGTGGCGCCAGCGTTTGTGGGGGGCGTCGTGCTGAAGCGCTGGGGGTTCAAGTGCACCTTT
ATCACTGGGCTGTGCATTTATGCCTGCGGCACTCTGGTCTTCTGGCCGTCAGCCGTGCTGACTTCGTACCCTGGT
TTCATCGTGTCCAATTTCATTGTGGGCAGTGGACTGGCGGTGCTGGAGACGGCCGCCAATCCGTTCATTGCGCTA
TGCGGACCACTCGAAAACTCGGAGATTCGGCTGAACATCTCGCAGGGCGTGCAGGCAATTGGCAGCGTCGTCTCG
CAGCTACTGGCCAAGAAGGTGCTGTTCAAATCTGTGACCGATGTGAGTACTCTGGTCGATGTGCAGTGGACATAT
TTGGGCATCGCACTGTTCGACGTACTCCTCGCTCTCGCTTTCTATTATCTGCCTATCCCCGAGGCATCGGACGAG
GATCTGGAGGAACTGGCCAACCGCCGCCGCGCCGACAACCGCGCCACCGTCGCTGGCATCCCCGTGGTTTGGCTG
ACACTGGGCCTCGGCGTCTGGTCTCAGTTTTTCTACGTGGCCGGCCAAGAAGTGATATCGATGAGCTTCGACAGC
TATGTCCGCACCGTGCACCCACTGTCCTATCTCAGTCCCTTTGAACAGCTCACGGTCGCACACACGGTGTTCGCG
GTCGGCCGCTTCCTCGCCGCCTTCGTCCAATGGTTCCTCAAACCCCGCTGGATACTTATGCTCTCTTACATCGGC
ATGATCGTCTTCTCCGTCCTGTGCATGAAAATGACCGGACGAGCCGCTGAAGCCATGGCTCTCATGGTGTACCTG
TTCGAGAGCGGCGTATTCAGTATCATTTTTGCCATCTCGCTGCGCGGCACCGGTCGACACACCAAGACCGCGACC
GTACTGCTCACGGTGGCCATCGGCGGCGGCGCCTTCTTCCCATTCGCGCAATACGCAGCCGAGCTGGCAGGCGGC
ATCCGCTATTCCTACTGCGTGCTGGTGGCGCTGTTCAGTGCGGGCGCCATCTTCCCCATCTACCTCAACGTAGTG
CCGGCAGCCAAGAAGCAGGTGGACCCGGTACCGAACGAGCACCTGCGACATCCCCGCCGGCGCAGTCGCATCAAA
GCCAACGTGATGGCGCGCGAAAAGGAGAACCCATCGGTGGGTGGGGTGCTCTCGCGCCGGCGCAGCGTAGTGTCG
GAGCCGTTGCCGACGGTGCAGCTGGCGGACCACACGAAGCAGACGTCGGGGGGATTGATGCATGAATTGGCGCCA
TGGCCAGAGCAGCGCGGGGAGCGTGCGGTGCAGACAGATTAA
Gene >Ani_SJS72_1|g969.t1
ATGCAAGACCAACGGCCCGAGGTTCTCACCGTCTCCATTGTCTTCTTCGTCATCGCAACTGTCTTCGTGGCCCTG
CGCTTCATCTCCCGCATCTTTATTGTCCAGAAGGTCGCCCTCCATGATTATTTGATGCTCCTGGCCTGGGTACCT
CCTCTTTTCCTCTTCCCCCCTCTCTCATCTCTCTAGTCAGCTCCTCATTCTCCGATCTTCCCGCAGGTCCTCGAC
TTCGGCTTTTCCTTCTCCCTCTTCTACGCCACCCACAAAGGTCTGGGTCTCCACGATACCGACATTCGCGAAGAC
CAACGCGCCGGCCTCAATCGCGCCGACTATGCCTTCACCGTCCTCTACGTGAGTCGCCCGTGGACTCCTCCGCCC
GTCGCTTCCCCTCTGACTGCCCCAGAACCCGGCCCTCATGGCCGTCAAAACCTCCATTCTGGTCTTCTACCTAAC
CCTCACCCAAGGCGAGAAGGTCTTTCGCTTGGCCAACTACGTGACTCTCTTCGTCGTCAATGCCGCCGGACTCGC
CTTGACCCTCGTGAATGTCTTCCAATGCCGTCCCGTCAGCGCGGCCGTTTCCTATCCCTTTCCCGAGGGTGCCAA
GTGCATCGACATCCTGACCCTATACCTATCCTCGTCGCCCGTCAACATTGTGACCGACTTGGCCATTCTCTTCCT
GCCCAATCCCATCCTGACGCAAATGCGACTGCCGCGCAAGCAAAAGATCATCCTCGTCATCACCTTCAGTTTTGG
TTTCTTTGTCGCCGTCGTCGATGTCATCCGCATTGCCTACATCCAGGATGCGGCCACCTCCCGTCAGATCGCGTT
GAGAGAGGTCCATCTGCAGGATACCCCGGGTGATGACCTCAGCTGTACGTCCCCTGTCCTTTCTTTCTCCCTATC
TTCCTGCTGATCGCCCCCAGGGTACGGGGCGTTTTCATTTATGTGGTCCGTCATCGAAGTCAACGTTTCCGTCAT
CTGTGCCTGTGTGCCCAGTCTCAAGCCGCTTGTCGCGCGACTCATCCCGAAGCTGATCCGTGACACTGACGGGAG
CTCCCAGGCCACCGACCTTCCCCTGCCCGCTCCCGATCCACCCCCTGAGATTCCGACCGTCACCGGGCCTCCTAC
TGCCCGGCGCGCGTCGCGCTCACCACAGTCCGCCAGCCAGGACAATAAGCCGTCGCATTCGGAGAGCCACAGCAG
TCATGCGGCCTCGGCCCGGGTTGACCTCTCCGATATGTTGACCAGCGCGCCCGAGGCGCCTCCGGATGTCGAGAA
CCGGACGAACACCGTCACCACAACCACGTCGTATCCGCCCAGCATCACCTTCTTCGACTTCGTCAATATGAAGAA
GCCGGCCAACATGCTGAAGCTGAGCAATAAGGAGTCCATTGCCCCGATCGCGCTGACCACCATCTTGTTCTTCCT
CTGGGGCTTTGCATACGGCTTGCTGGCTATCCTGAACGAGCAGATTCAGGATATCCTGGGCCTGGACGTCTGGCA
GTCATTTGGTCTGCATGCGGTGTACTTTGGGGGGTATCTGGTGGCGCCAGCGTTTGTGGGGGGCGTCGTGCTGAA
GCGCTGGGGGTTCAAGTGCACCTTTATCACTGGGCTGTGCATTTATGCCTGCGGCACTCTGGTCTTCTGGCCGTC
AGCCGTGCTGACTTCGTACCCTGGTTTCATCGTGTCCAATTTCATTGTGGGCAGTGGACTGGCGGTGCTGGAGAC
GGCCGCCAATCCGTTCATTGCGCTATGCGGACCACTCGAAAACTCGGAGATTCGGCTGAACATCTCGCAGGGCGT
GCAGGCAATTGGCAGCGTCGTCTCGCAGCTACTGGCCAAGAAGGTGCTGTTCAAATCTGTGACCGATGTGAGTAC
TCTGGTCGATGTGCAGTGGACATATTTGGGCATCGCACTGTTCGACGTACTCCTCGCTCTCGCTTTCTATTATCT
GCCTATCCCCGAGGCATCGGACGAGGATCTGGAGGAACTGGCCAACCGCCGCCGCGCCGACAACCGCGCCACCGT
CGCTGGCATCCCCGTGGTTTGGCTGACACTGGGCCTCGGCGTCTGGTCTCAGTTTTTCTACGTGGCCGGCCAAGA
AGTGATATCGATGAGCTTCGACAGCTATGTCCGCACCGTGCACCCACTGTCCTATCTCAGTCCCTTTGAACAGCT
CACGGTCGCACACACGGTGTTCGCGGTCGGCCGCTTCCTCGCCGCCTTCGTCCAATGGTTCCTCAAACCCCGCTG
GATACTTATGCTCTCTTACATCGGCATGATCGTCTTCTCCGTCCTGTGCATGAAAATGACCGGACGAGCCGCTGA
AGCCATGGCTCTCATGGTGTACCTGTTCGAGAGCGGCGTATTCAGTATCATTTTTGCCATCTCGCTGCGCGGCAC
CGGTCGACACACCAAGACCGCGACCGTACTGCTCACGGTGGCCATCGGCGGCGGCGCCTTCTTCCCATTCGCGCA
ATACGCAGCCGAGCTGGCAGGCGGCATCCGCTATTCCTACTGCGTGCTGGTGGCGCTGTTCAGTGCGGGCGCCAT
CTTCCCCATCTACCTCAACGTAGTGCCGGCAGCCAAGAAGCAGGTGGACCCGGTACCGAACGAGCACCTGCGACA
TCCCCGCCGGCGCAGTCGCATCAAAGCCAACGTGATGGCGCGCGAAAAGGAGAACCCATCGGTGGGTGGGGTGCT
CTCGCGCCGGCGCAGCGTAGTGTCGGAGCCGTTGCCGACGGTGCAGCTGGCGGACCACACGAAGCAGACGTCGGG
GGGATTGATGCATGAATTGGCGCCATGGCCAGAGCAGCGCGGGGAGCGTGCGGTGCAGACAGATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail