Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g9619.t1
Gene name
Locationscaffold_107:73752..75233
Strand+
Gene length (bp)1481
Transcript length (bp)1350
Coding sequence length (bp)1350
Protein length (aa) 450

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 9.9E-28 19 372
PF00890 FAD_binding_2 FAD binding domain 1.6E-06 20 51
PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 9.7E-05 19 55
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 8.8E-06 22 50
PF01134 GIDA Glucose inhibited division protein A 5.3E-05 20 142

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0000166 nucleotide binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g9619.t1
MNTYKDTFHLPHIKGQPLHVLIVGAGIAGLSAALAIHKTGHKVTILERVREIAEVGAGIQMAPNAARILGRLGLL
EKVMEKANALEMNSLRRYKNDEELGKAELMPSVGEKYHAPLAVIHRGDLQSILLEAVRSENIPIRTDSRVVCAAP
DFSARVQLHTGEWVSGDVVIGADGIKSDLRHQMAAHHGVKDICQPTGDAAYRIQIPEDKMKGDPRARELLKKNVG
MRWMGPEGHIMAYPMKNNTVYNMVLLHPQKEGAETEESWTNKGDKREMEEFYSDWNGLVRDLLSYVPDGEVMEWT
LNSHFPLPTWIENRVVLMGDACHPMLPYVAQGAAQAIEDAGVLGCVLALTDDIDSALAVYERVRKERAERIQKSA
AVTRKALHLPDGEEQRKRDEAIRGPGKNPDLWADKSWQDFMWGTDVMKETVDNFDDLVARSHGYHPHALNAVAY*
Coding >Ani_SJS72_1|g9619.t1
ATGAACACCTACAAAGACACCTTCCACCTCCCCCACATCAAGGGTCAACCCCTGCACGTTCTAATCGTCGGCGCC
GGCATCGCAGGCCTCTCGGCCGCCCTGGCGATACACAAGACCGGCCACAAAGTCACCATTCTCGAGCGGGTGCGG
GAAATCGCCGAGGTCGGGGCAGGCATCCAGATGGCGCCGAATGCAGCGCGGATTCTCGGTCGCTTGGGTTTGCTG
GAAAAGGTCATGGAGAAGGCGAATGCGCTAGAGATGAATTCTCTCCGCAGGTATAAGAACGATGAGGAATTGGGG
AAGGCGGAGTTGATGCCTTCCGTCGGAGAAAAGTATCACGCTCCCCTTGCAGTCATCCATCGTGGCGACTTACAA
AGTATCCTGCTTGAGGCGGTACGGTCGGAAAATATCCCCATTCGAACTGATTCGCGAGTCGTCTGTGCGGCGCCC
GATTTCTCTGCGCGCGTGCAACTTCATACCGGGGAATGGGTATCCGGGGATGTTGTCATCGGGGCGGATGGGATC
AAGTCCGATCTGCGACACCAGATGGCGGCGCATCATGGAGTGAAGGATATTTGTCAGCCGACCGGGGATGCGGCG
TACCGGATCCAGATCCCTGAGGACAAGATGAAAGGGGATCCGCGGGCGCGGGAACTATTGAAGAAGAATGTTGGG
ATGCGGTGGATGGGACCGGAAGGCCATATTATGGCGTACCCGATGAAGAACAATACCGTGTATAATATGGTGTTG
CTGCATCCGCAGAAAGAAGGCGCGGAGACGGAGGAAAGCTGGACGAATAAGGGAGATAAGCGGGAGATGGAGGAA
TTTTATTCCGATTGGAATGGACTCGTTCGCGATTTATTGAGTTATGTTCCTGACGGGGAGGTGATGGAGTGGACG
CTGAATTCGCATTTCCCGCTGCCGACGTGGATTGAGAATCGCGTGGTTTTGATGGGCGATGCGTGCCATCCTATG
CTGCCGTATGTGGCGCAGGGAGCGGCGCAGGCGATCGAGGATGCTGGGGTGCTCGGGTGTGTGTTGGCTTTGACG
GACGATATCGATAGCGCATTGGCGGTTTATGAGCGGGTACGAAAGGAACGCGCCGAACGGATCCAGAAGAGCGCA
GCGGTTACGCGGAAAGCGCTGCATTTGCCCGATGGCGAGGAACAGCGCAAGCGCGATGAGGCTATTCGCGGCCCT
GGGAAGAATCCGGATCTTTGGGCGGATAAATCCTGGCAGGATTTCATGTGGGGTACGGATGTCATGAAGGAGACG
GTCGATAACTTCGACGATTTAGTTGCTCGCAGTCACGGATACCACCCACATGCGTTGAATGCGGTGGCTTATTAG
Transcript >Ani_SJS72_1|g9619.t1
ATGAACACCTACAAAGACACCTTCCACCTCCCCCACATCAAGGGTCAACCCCTGCACGTTCTAATCGTCGGCGCC
GGCATCGCAGGCCTCTCGGCCGCCCTGGCGATACACAAGACCGGCCACAAAGTCACCATTCTCGAGCGGGTGCGG
GAAATCGCCGAGGTCGGGGCAGGCATCCAGATGGCGCCGAATGCAGCGCGGATTCTCGGTCGCTTGGGTTTGCTG
GAAAAGGTCATGGAGAAGGCGAATGCGCTAGAGATGAATTCTCTCCGCAGGTATAAGAACGATGAGGAATTGGGG
AAGGCGGAGTTGATGCCTTCCGTCGGAGAAAAGTATCACGCTCCCCTTGCAGTCATCCATCGTGGCGACTTACAA
AGTATCCTGCTTGAGGCGGTACGGTCGGAAAATATCCCCATTCGAACTGATTCGCGAGTCGTCTGTGCGGCGCCC
GATTTCTCTGCGCGCGTGCAACTTCATACCGGGGAATGGGTATCCGGGGATGTTGTCATCGGGGCGGATGGGATC
AAGTCCGATCTGCGACACCAGATGGCGGCGCATCATGGAGTGAAGGATATTTGTCAGCCGACCGGGGATGCGGCG
TACCGGATCCAGATCCCTGAGGACAAGATGAAAGGGGATCCGCGGGCGCGGGAACTATTGAAGAAGAATGTTGGG
ATGCGGTGGATGGGACCGGAAGGCCATATTATGGCGTACCCGATGAAGAACAATACCGTGTATAATATGGTGTTG
CTGCATCCGCAGAAAGAAGGCGCGGAGACGGAGGAAAGCTGGACGAATAAGGGAGATAAGCGGGAGATGGAGGAA
TTTTATTCCGATTGGAATGGACTCGTTCGCGATTTATTGAGTTATGTTCCTGACGGGGAGGTGATGGAGTGGACG
CTGAATTCGCATTTCCCGCTGCCGACGTGGATTGAGAATCGCGTGGTTTTGATGGGCGATGCGTGCCATCCTATG
CTGCCGTATGTGGCGCAGGGAGCGGCGCAGGCGATCGAGGATGCTGGGGTGCTCGGGTGTGTGTTGGCTTTGACG
GACGATATCGATAGCGCATTGGCGGTTTATGAGCGGGTACGAAAGGAACGCGCCGAACGGATCCAGAAGAGCGCA
GCGGTTACGCGGAAAGCGCTGCATTTGCCCGATGGCGAGGAACAGCGCAAGCGCGATGAGGCTATTCGCGGCCCT
GGGAAGAATCCGGATCTTTGGGCGGATAAATCCTGGCAGGATTTCATGTGGGGTACGGATGTCATGAAGGAGACG
GTCGATAACTTCGACGATTTAGTTGCTCGCAGTCACGGATACCACCCACATGCGTTGAATGCGGTGGCTTATTAG
Gene >Ani_SJS72_1|g9619.t1
ATGAACACCTACAAAGACACCTTCCACCTCCCCCACATCAAGGGTCAACCCCTGCACGTTCTAATCGTCGGCGCC
GGCATCGCAGGCCTCTCGGCCGCCCTGGCGATACACAAGACCGGCCACAAAGTCACCATTCTCGAGCGGGTGCGG
GAAATCGCCGAGGTCGGGGCAGGCATCCAGATGGCGCCGAATGCAGCGCGGATTCTCGGTCGCTTGGGTTTGCTG
GAAAAGGTCATGGAGAAGGCGAATGCGCTAGAGATGAATTCTCTCCGCAGGTATAAGAACGATGAGGAATTGGGG
AAGGCGGAGTTGATGCCTTCCGTATGTTATGCCTTACCTTGCGTCATTGCGGGGGTTCTGTGGAAGCTAATGTGG
TGTAGGTCGGAGAAAAGTATCACGCTCCCCTTGCAGTCATCCATCGTGGCGACTTACAAAGTATCCTGCTTGAGG
CGGTACGGTCGGAAAATATCCCCATTCGAACTGATTCGCGAGTCGTCTGTGCGGCGCCCGATTTCTCTGCGCGCG
TGCAACTTCATACCGGGGAATGGGTATCCGGGGATGTTGTCATCGGGGCGGATGGGATCAAGTCCGATCTGCGAC
ACCAGATGGCGGCGCATCATGGAGTGAAGGATATTTGTCAGCCGACCGGGGATGCGGCGTACCGGATCCAGATCC
CTGAGGACAAGATGAAAGGGGATCCGCGGGCGCGGGAACTATTGAAGAAGAATGTTGGGATGCGGTGGATGGGAC
CGGAAGGCCATATTATGGCGTACCCGATGAAGAACAATACCGTGTATAATATGGTGTTGCTGCATCCGCAGAAAG
AAGGCGCGGAGACGGAGGAAAGCTGGACGAATAAGGGAGATAAGCGGGAGATGGAGGAATTTTATTCCGATTGGA
ATGGACTCGTTCGCGATTTATTGAGTTATGTTCCTGACGGGGAGGTGATGGAGTGGACGCTGAATTCGCATTTCC
CGCTGCCGACGTGGATTGAGAATCGCGTGGTTTTGATGGGCGATGCGTGCCATCCTATGCTGCCGTATGTGGCGC
AGGGAGCGGCGCAGGCGATCGAGGATGCTGGGGTGCTCGGGTGTGTGTTGGCTTTGACGGACGATATCGATAGCG
CATTGGCGGTTTATGAGCGGGTACGAAAGGAACGCGCCGAACGGATCCAGAAGAGCGCAGCGGTTACGCGGAAAG
CGCTGCATTTGCCCGATGGCGAGGAACAGCGCAAGCGCGATGAGGCTATTCGCGGCCCTGGGAAGAATCCGGATC
TTTGGGCGGATAAATCCTGGCAGGATTTCATGTGGGGTGAGTTTGTGCCATTCTGATTTATGCGGCGGTCTTGAA
GGTGCGATACTGACGGTGGTTATGTTACTGTAGGTACGGATGTCATGAAGGAGACGGTCGATAACTTCGACGATT
TAGTTGCTCGCAGTCACGGATACCACCCACATGCGTTGAATGCGGTGGCTTATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail