Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g9599.t1
Gene name
Locationscaffold_107:15794..20335
Strand+
Gene length (bp)4541
Transcript length (bp)4452
Coding sequence length (bp)4452
Protein length (aa) 1484

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15902 Sortilin-Vps10 Sortilin, neurotensin receptor 3, 7.1E-141 61 502
PF15902 Sortilin-Vps10 Sortilin, neurotensin receptor 3, 6.8E-163 715 1162
PF15901 Sortilin_C Sortilin, neurotensin receptor 3, C-terminal 1.3E-44 506 664
PF15901 Sortilin_C Sortilin, neurotensin receptor 3, C-terminal 3.1E-45 1164 1335
PF15899 BNR_6 BNR-Asp box repeat 3.6E-02 716 728

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 1351 1373 22
2 1394 1416 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g9599.t1
MIFRWLLLVSCLLVALIPQQSSAKKSDQPKVTATKLEHEPFSLFYFEDSETVLMSLKNGEFKQSFDGGEEWEDVA
SSEDGRVTQPVVFIRQHPFDKNKAYALGVDGHHLVTTDQAKTWRSFDIGDQPALQHPPLVFHGWDSSKVIYQSEE
CAGFFCIVRSYYTTDDFKTVRLLRESAAGCSWAVGHPHFAEDMDLNQELKDRSLCVVPGLKVPFGHANRLVYSDD
YFVSNIEGTEVNLHEGRPVSGVISTAAVKKFIVAAVKSKGTEELALFVTTDTNTWHRAEFDGHRIEQDAYTMLES
TNYSLQVDVLTSPSSNMGVLFTSNSNGTFFSRNIEHTNRDMEGTVDFEKIAGIQGIVMVNTVKNPKEVKSGQAKK
VISRISFDDGRSFQPLKVGDKNLHLHSVTTFANIGRVFSSPAPGLVMGIGNTGDHLQKYSDGDLYISDDAGVTWR
HALDGPHKYEFGDQGAVVMAISDKGKSNKISFSLDHGKEWGSVEIEHKIYPTMVTTTPDSTSLRFLLVGKQNEES
GFIVYSIDFKGLHERKCEEDDFEKWPARLDENGEPDCLMGHKQFFRRRKANADCFVDEEFKDPQPIMEPCKCTAE
DFECEFKGSEDGKSCIPALLPVPPEGCKNPDDTFMGPSGWRLIPGDTCIRDGGKNLDHDVEWRCKDAGNVPTSGE
ISVEKQYFDARQFSAYYYLERQSSSSGNDETIVMLTSERALYVSHDHGKTWKQPLKGEAINRIVPHPYNSDGAFL
LTDGAEGFWTVDRGQSFKPFDAPAPPTEERLPTLTFHPQYQDWLIWTGAVDCGSGDCHSNAYISKNRGDNWELLQ
RYVQKCEFESREGRKDSTNLIFCEQFENENRNNRLQLVSSKNWFSDSTVHFRDVINYATMSEFIVVASRDTEKPD
SLVASSSVDGETFAEAKFPPNVNVPVQTAYTVLESSTHAVFLHVTVSNSEGAEYGSIIKSNSNGTSYVLSLGAVN
RNFRGYVDFEKMQGIEGVAVANVVSNVNKLSDGEPKKLRTMITHNDGGQWTLLSPPNKDAEGKDFGCSVEGEGVP
GCSLHLHGYTERRDERDTFSSSSAIGLMLGVGNVGDHLGGEDEADTFITRDAGFTWKSVKKGRYIWEFGDAGSLI
VIVPESKPTKTLYYSLDEGDTWLDFVFSDVEMQIDDISTVPSDTSKSFLLWGKELKSDYQDKLATVSVDFSGLRS
SSCKLDENSAESHDYYLWEPKHPFQSDNCLFGHVEQYHRKKPSAQCWNDWREPHVHSIGENCPCTRADFECDYNY
EPQSDGSCALVQGLAPPDAMAVCREDPEAYQYWEPSGYRRLPQSTCQGGREMDHIVSKPCPNREEEYKKKHGISG
AGLFFAIVIPIAVASAVGYYGYTRWDGKFGQIRLGENVGTSQGLLSRDSLLITIPVTIIAGAVAVIKALPLLATS
LWRSASGYVRLGRNRGYSRPYASRGSFAARRGDYTGVVDDEDELLGVEDLEADEEEEL*
Coding >Ani_SJS72_1|g9599.t1
ATGATCTTCCGATGGCTCCTGCTGGTGAGCTGCCTTTTGGTGGCTCTCATTCCCCAGCAAAGCTCTGCGAAGAAA
TCCGATCAACCGAAGGTCACGGCAACCAAGCTTGAACACGAACCCTTTTCTCTCTTCTATTTTGAGGACTCGGAA
ACTGTTCTTATGAGCTTGAAAAATGGAGAATTCAAACAGTCTTTCGACGGTGGAGAGGAATGGGAAGACGTGGCT
AGCAGCGAGGATGGTAGAGTGACACAACCGGTTGTTTTCATACGACAGCACCCATTCGACAAGAATAAGGCCTAT
GCTCTCGGTGTTGACGGACATCACTTGGTCACCACAGATCAGGCCAAGACGTGGAGATCGTTCGATATAGGCGAC
CAGCCGGCCTTACAGCACCCGCCCCTTGTTTTTCATGGATGGGACTCGAGTAAAGTCATATATCAAAGCGAAGAG
TGTGCCGGGTTCTTCTGCATTGTGAGGTCGTACTACACAACTGATGATTTCAAGACCGTTAGGCTGTTGCGGGAG
AGTGCGGCGGGGTGCTCCTGGGCAGTTGGGCACCCTCACTTCGCCGAAGATATGGATTTGAACCAAGAGTTGAAG
GACAGATCACTGTGTGTCGTCCCTGGGTTGAAGGTGCCCTTTGGACACGCCAACCGCTTGGTATACTCGGATGAT
TACTTCGTTAGTAACATCGAAGGCACAGAGGTGAACTTACATGAGGGCCGGCCTGTCTCCGGCGTCATTAGCACA
GCCGCTGTCAAGAAGTTCATCGTGGCCGCCGTCAAATCCAAAGGAACAGAAGAGCTTGCCTTGTTTGTGACAACG
GATACGAATACCTGGCATCGAGCCGAATTCGATGGACATCGGATAGAGCAGGACGCGTATACAATGTTGGAGAGC
ACCAACTATAGCCTGCAGGTAGACGTCCTGACTAGCCCATCTAGCAACATGGGTGTCCTATTCACTTCCAATTCG
AACGGCACATTCTTCAGCCGTAATATTGAACACACCAATCGCGATATGGAAGGGACTGTCGATTTCGAGAAGATT
GCTGGCATTCAAGGCATAGTTATGGTCAATACGGTGAAAAACCCGAAAGAGGTTAAGTCCGGGCAAGCGAAAAAG
GTCATCAGTAGAATAAGTTTCGATGATGGGCGAAGTTTCCAGCCTCTCAAGGTTGGTGACAAGAATCTACATTTA
CATTCCGTGACTACGTTCGCCAATATCGGCCGGGTATTCTCAAGTCCAGCACCAGGATTAGTCATGGGAATCGGC
AATACAGGTGATCACCTTCAAAAATACAGCGATGGCGATCTTTATATTTCAGACGATGCTGGTGTGACTTGGCGT
CATGCCCTTGACGGGCCGCATAAGTACGAATTTGGCGACCAAGGAGCTGTGGTTATGGCAATCAGCGACAAGGGC
AAATCCAACAAGATCAGCTTTTCTCTTGACCATGGCAAAGAATGGGGATCAGTGGAGATCGAACATAAGATATAT
CCTACTATGGTCACAACGACACCGGACTCCACGAGTCTAAGATTTTTACTAGTCGGCAAGCAAAACGAGGAAAGC
GGATTCATTGTCTATTCCATCGACTTCAAGGGATTGCATGAGCGGAAATGCGAAGAAGATGACTTTGAGAAGTGG
CCAGCTAGACTAGACGAAAACGGCGAGCCAGACTGCTTGATGGGTCATAAACAATTCTTCCGCCGCAGAAAGGCG
AATGCTGACTGCTTCGTGGATGAGGAGTTCAAAGATCCTCAGCCGATTATGGAGCCATGCAAATGTACGGCAGAA
GACTTTGAATGTGAATTCAAAGGCAGCGAGGATGGGAAGAGTTGCATCCCGGCCCTACTGCCGGTGCCTCCAGAA
GGGTGCAAGAACCCCGATGATACCTTCATGGGACCGTCTGGTTGGAGACTGATACCAGGTGACACTTGCATCCGT
GATGGCGGTAAGAATCTGGATCACGATGTTGAGTGGCGTTGCAAGGATGCAGGCAATGTACCCACATCTGGCGAA
ATCAGCGTGGAAAAACAATACTTTGATGCAAGGCAATTCAGCGCCTATTATTACCTAGAACGTCAGTCAAGCAGT
TCTGGCAATGACGAGACGATTGTTATGCTCACCAGTGAACGTGCGCTCTATGTATCACATGATCATGGGAAGACA
TGGAAGCAGCCACTGAAAGGAGAAGCTATCAACAGAATCGTTCCTCACCCGTACAACAGTGATGGTGCTTTTCTC
TTGACGGACGGTGCGGAGGGCTTTTGGACTGTTGATCGTGGCCAGTCTTTCAAGCCTTTCGATGCACCAGCGCCT
CCAACTGAAGAACGCCTTCCAACCCTCACGTTCCATCCCCAATATCAAGACTGGCTGATCTGGACAGGGGCTGTT
GATTGCGGATCTGGTGATTGTCACTCCAACGCCTACATCAGTAAAAACCGCGGGGACAATTGGGAGCTGCTGCAA
CGCTATGTTCAAAAGTGTGAATTCGAAAGCAGGGAAGGCCGCAAAGATAGCACGAACCTCATATTCTGCGAGCAA
TTCGAGAATGAGAACAGAAACAACCGACTACAACTGGTATCCAGTAAGAACTGGTTTTCAGACTCGACCGTCCAT
TTCAGAGATGTCATCAACTATGCCACCATGTCCGAGTTCATTGTTGTGGCGTCTCGAGATACAGAAAAGCCAGAC
TCTTTGGTCGCGAGCAGCAGTGTCGATGGTGAGACATTTGCGGAGGCAAAATTTCCTCCAAATGTCAACGTCCCT
GTCCAAACGGCATATACTGTGCTTGAGAGTTCTACTCACGCCGTTTTTCTGCATGTTACAGTAAGTAACTCGGAG
GGGGCCGAGTACGGATCGATTATCAAGAGTAATAGCAACGGAACTTCCTATGTGCTCAGCCTTGGTGCAGTGAAT
CGAAATTTTCGGGGTTATGTCGACTTTGAGAAGATGCAAGGTATAGAAGGCGTGGCAGTTGCAAACGTTGTCAGT
AACGTGAATAAGCTGTCAGATGGGGAGCCGAAAAAGTTAAGGACAATGATTACGCACAATGATGGAGGGCAATGG
ACCTTGCTTTCTCCCCCAAATAAGGATGCAGAGGGCAAGGACTTTGGGTGTTCTGTGGAAGGAGAAGGCGTTCCT
GGCTGTTCGCTCCACCTTCACGGCTATACAGAACGTAGGGATGAGCGGGACACGTTTTCGTCCAGTTCAGCAATC
GGCTTGATGCTCGGAGTCGGCAACGTTGGTGACCACCTCGGTGGCGAAGACGAAGCCGATACGTTCATAACCCGG
GATGCTGGCTTCACATGGAAGTCGGTCAAGAAGGGCAGGTACATCTGGGAGTTTGGTGATGCCGGCTCCTTGATT
GTGATCGTGCCTGAGTCGAAGCCGACCAAAACTCTTTACTACAGCCTTGACGAGGGAGACACGTGGTTAGACTTT
GTCTTCTCGGACGTGGAGATGCAGATTGATGATATCTCCACCGTACCGTCCGACACGTCCAAGAGCTTTCTTCTC
TGGGGCAAAGAATTGAAATCGGATTACCAAGATAAGCTCGCGACAGTAAGTGTTGACTTCAGTGGGCTCCGTTCC
TCCTCGTGTAAATTGGACGAAAATAGTGCCGAGAGCCATGATTATTACCTCTGGGAACCGAAGCATCCGTTCCAA
AGTGATAATTGCCTGTTTGGTCATGTTGAGCAATATCATCGGAAGAAACCGTCAGCCCAATGTTGGAACGACTGG
CGTGAACCTCATGTTCACAGTATCGGAGAGAACTGCCCCTGTACAAGGGCTGACTTTGAATGTGACTACAACTAC
GAGCCTCAGAGTGATGGCAGCTGTGCCCTTGTTCAAGGACTCGCTCCTCCTGATGCCATGGCTGTATGCAGAGAA
GACCCTGAAGCATATCAATATTGGGAACCCTCAGGATATCGGCGTCTCCCCCAATCAACGTGTCAGGGTGGACGG
GAAATGGATCATATTGTTTCCAAGCCTTGCCCAAACAGAGAGGAAGAGTATAAGAAGAAGCATGGGATAAGCGGC
GCAGGTCTCTTCTTCGCGATCGTCATCCCTATTGCTGTAGCAAGCGCTGTCGGTTACTATGGCTATACTAGGTGG
GACGGCAAGTTTGGCCAAATTCGGCTTGGAGAGAATGTTGGTACCTCCCAGGGTCTGCTTTCGCGAGATTCTCTG
CTCATCACCATCCCGGTTACCATAATTGCGGGTGCGGTGGCCGTCATAAAGGCTCTCCCACTGTTAGCTACAAGT
CTCTGGCGGAGCGCGAGCGGATATGTGCGCCTAGGACGCAACCGGGGCTACTCCAGGCCTTATGCGTCTCGCGGA
TCATTTGCCGCCAGGCGCGGCGACTACACTGGTGTTGTTGATGACGAGGATGAGCTTCTTGGTGTGGAAGATCTC
GAAGCGGATGAAGAGGAAGAGCTGTAA
Transcript >Ani_SJS72_1|g9599.t1
ATGATCTTCCGATGGCTCCTGCTGGTGAGCTGCCTTTTGGTGGCTCTCATTCCCCAGCAAAGCTCTGCGAAGAAA
TCCGATCAACCGAAGGTCACGGCAACCAAGCTTGAACACGAACCCTTTTCTCTCTTCTATTTTGAGGACTCGGAA
ACTGTTCTTATGAGCTTGAAAAATGGAGAATTCAAACAGTCTTTCGACGGTGGAGAGGAATGGGAAGACGTGGCT
AGCAGCGAGGATGGTAGAGTGACACAACCGGTTGTTTTCATACGACAGCACCCATTCGACAAGAATAAGGCCTAT
GCTCTCGGTGTTGACGGACATCACTTGGTCACCACAGATCAGGCCAAGACGTGGAGATCGTTCGATATAGGCGAC
CAGCCGGCCTTACAGCACCCGCCCCTTGTTTTTCATGGATGGGACTCGAGTAAAGTCATATATCAAAGCGAAGAG
TGTGCCGGGTTCTTCTGCATTGTGAGGTCGTACTACACAACTGATGATTTCAAGACCGTTAGGCTGTTGCGGGAG
AGTGCGGCGGGGTGCTCCTGGGCAGTTGGGCACCCTCACTTCGCCGAAGATATGGATTTGAACCAAGAGTTGAAG
GACAGATCACTGTGTGTCGTCCCTGGGTTGAAGGTGCCCTTTGGACACGCCAACCGCTTGGTATACTCGGATGAT
TACTTCGTTAGTAACATCGAAGGCACAGAGGTGAACTTACATGAGGGCCGGCCTGTCTCCGGCGTCATTAGCACA
GCCGCTGTCAAGAAGTTCATCGTGGCCGCCGTCAAATCCAAAGGAACAGAAGAGCTTGCCTTGTTTGTGACAACG
GATACGAATACCTGGCATCGAGCCGAATTCGATGGACATCGGATAGAGCAGGACGCGTATACAATGTTGGAGAGC
ACCAACTATAGCCTGCAGGTAGACGTCCTGACTAGCCCATCTAGCAACATGGGTGTCCTATTCACTTCCAATTCG
AACGGCACATTCTTCAGCCGTAATATTGAACACACCAATCGCGATATGGAAGGGACTGTCGATTTCGAGAAGATT
GCTGGCATTCAAGGCATAGTTATGGTCAATACGGTGAAAAACCCGAAAGAGGTTAAGTCCGGGCAAGCGAAAAAG
GTCATCAGTAGAATAAGTTTCGATGATGGGCGAAGTTTCCAGCCTCTCAAGGTTGGTGACAAGAATCTACATTTA
CATTCCGTGACTACGTTCGCCAATATCGGCCGGGTATTCTCAAGTCCAGCACCAGGATTAGTCATGGGAATCGGC
AATACAGGTGATCACCTTCAAAAATACAGCGATGGCGATCTTTATATTTCAGACGATGCTGGTGTGACTTGGCGT
CATGCCCTTGACGGGCCGCATAAGTACGAATTTGGCGACCAAGGAGCTGTGGTTATGGCAATCAGCGACAAGGGC
AAATCCAACAAGATCAGCTTTTCTCTTGACCATGGCAAAGAATGGGGATCAGTGGAGATCGAACATAAGATATAT
CCTACTATGGTCACAACGACACCGGACTCCACGAGTCTAAGATTTTTACTAGTCGGCAAGCAAAACGAGGAAAGC
GGATTCATTGTCTATTCCATCGACTTCAAGGGATTGCATGAGCGGAAATGCGAAGAAGATGACTTTGAGAAGTGG
CCAGCTAGACTAGACGAAAACGGCGAGCCAGACTGCTTGATGGGTCATAAACAATTCTTCCGCCGCAGAAAGGCG
AATGCTGACTGCTTCGTGGATGAGGAGTTCAAAGATCCTCAGCCGATTATGGAGCCATGCAAATGTACGGCAGAA
GACTTTGAATGTGAATTCAAAGGCAGCGAGGATGGGAAGAGTTGCATCCCGGCCCTACTGCCGGTGCCTCCAGAA
GGGTGCAAGAACCCCGATGATACCTTCATGGGACCGTCTGGTTGGAGACTGATACCAGGTGACACTTGCATCCGT
GATGGCGGTAAGAATCTGGATCACGATGTTGAGTGGCGTTGCAAGGATGCAGGCAATGTACCCACATCTGGCGAA
ATCAGCGTGGAAAAACAATACTTTGATGCAAGGCAATTCAGCGCCTATTATTACCTAGAACGTCAGTCAAGCAGT
TCTGGCAATGACGAGACGATTGTTATGCTCACCAGTGAACGTGCGCTCTATGTATCACATGATCATGGGAAGACA
TGGAAGCAGCCACTGAAAGGAGAAGCTATCAACAGAATCGTTCCTCACCCGTACAACAGTGATGGTGCTTTTCTC
TTGACGGACGGTGCGGAGGGCTTTTGGACTGTTGATCGTGGCCAGTCTTTCAAGCCTTTCGATGCACCAGCGCCT
CCAACTGAAGAACGCCTTCCAACCCTCACGTTCCATCCCCAATATCAAGACTGGCTGATCTGGACAGGGGCTGTT
GATTGCGGATCTGGTGATTGTCACTCCAACGCCTACATCAGTAAAAACCGCGGGGACAATTGGGAGCTGCTGCAA
CGCTATGTTCAAAAGTGTGAATTCGAAAGCAGGGAAGGCCGCAAAGATAGCACGAACCTCATATTCTGCGAGCAA
TTCGAGAATGAGAACAGAAACAACCGACTACAACTGGTATCCAGTAAGAACTGGTTTTCAGACTCGACCGTCCAT
TTCAGAGATGTCATCAACTATGCCACCATGTCCGAGTTCATTGTTGTGGCGTCTCGAGATACAGAAAAGCCAGAC
TCTTTGGTCGCGAGCAGCAGTGTCGATGGTGAGACATTTGCGGAGGCAAAATTTCCTCCAAATGTCAACGTCCCT
GTCCAAACGGCATATACTGTGCTTGAGAGTTCTACTCACGCCGTTTTTCTGCATGTTACAGTAAGTAACTCGGAG
GGGGCCGAGTACGGATCGATTATCAAGAGTAATAGCAACGGAACTTCCTATGTGCTCAGCCTTGGTGCAGTGAAT
CGAAATTTTCGGGGTTATGTCGACTTTGAGAAGATGCAAGGTATAGAAGGCGTGGCAGTTGCAAACGTTGTCAGT
AACGTGAATAAGCTGTCAGATGGGGAGCCGAAAAAGTTAAGGACAATGATTACGCACAATGATGGAGGGCAATGG
ACCTTGCTTTCTCCCCCAAATAAGGATGCAGAGGGCAAGGACTTTGGGTGTTCTGTGGAAGGAGAAGGCGTTCCT
GGCTGTTCGCTCCACCTTCACGGCTATACAGAACGTAGGGATGAGCGGGACACGTTTTCGTCCAGTTCAGCAATC
GGCTTGATGCTCGGAGTCGGCAACGTTGGTGACCACCTCGGTGGCGAAGACGAAGCCGATACGTTCATAACCCGG
GATGCTGGCTTCACATGGAAGTCGGTCAAGAAGGGCAGGTACATCTGGGAGTTTGGTGATGCCGGCTCCTTGATT
GTGATCGTGCCTGAGTCGAAGCCGACCAAAACTCTTTACTACAGCCTTGACGAGGGAGACACGTGGTTAGACTTT
GTCTTCTCGGACGTGGAGATGCAGATTGATGATATCTCCACCGTACCGTCCGACACGTCCAAGAGCTTTCTTCTC
TGGGGCAAAGAATTGAAATCGGATTACCAAGATAAGCTCGCGACAGTAAGTGTTGACTTCAGTGGGCTCCGTTCC
TCCTCGTGTAAATTGGACGAAAATAGTGCCGAGAGCCATGATTATTACCTCTGGGAACCGAAGCATCCGTTCCAA
AGTGATAATTGCCTGTTTGGTCATGTTGAGCAATATCATCGGAAGAAACCGTCAGCCCAATGTTGGAACGACTGG
CGTGAACCTCATGTTCACAGTATCGGAGAGAACTGCCCCTGTACAAGGGCTGACTTTGAATGTGACTACAACTAC
GAGCCTCAGAGTGATGGCAGCTGTGCCCTTGTTCAAGGACTCGCTCCTCCTGATGCCATGGCTGTATGCAGAGAA
GACCCTGAAGCATATCAATATTGGGAACCCTCAGGATATCGGCGTCTCCCCCAATCAACGTGTCAGGGTGGACGG
GAAATGGATCATATTGTTTCCAAGCCTTGCCCAAACAGAGAGGAAGAGTATAAGAAGAAGCATGGGATAAGCGGC
GCAGGTCTCTTCTTCGCGATCGTCATCCCTATTGCTGTAGCAAGCGCTGTCGGTTACTATGGCTATACTAGGTGG
GACGGCAAGTTTGGCCAAATTCGGCTTGGAGAGAATGTTGGTACCTCCCAGGGTCTGCTTTCGCGAGATTCTCTG
CTCATCACCATCCCGGTTACCATAATTGCGGGTGCGGTGGCCGTCATAAAGGCTCTCCCACTGTTAGCTACAAGT
CTCTGGCGGAGCGCGAGCGGATATGTGCGCCTAGGACGCAACCGGGGCTACTCCAGGCCTTATGCGTCTCGCGGA
TCATTTGCCGCCAGGCGCGGCGACTACACTGGTGTTGTTGATGACGAGGATGAGCTTCTTGGTGTGGAAGATCTC
GAAGCGGATGAAGAGGAAGAGCTGTAA
Gene >Ani_SJS72_1|g9599.t1
ATGATCTTCCGATGGCTCCTGCTGGTGAGCTGCCTTTTGGTGGCTCTCATTCCCCAGCAAAGCTCTGCGAAGAAA
TCCGATCAACCGAAGGTCACGGCAACCAAGCTTGAACACGAACCCTTTTCTCTCTTCTATTTTGAGGACTCGGAA
ACTGTTCTTATGAGCTTGAAAAATGGAGAATTCAAACAGTCTTTCGACGGTGGAGAGGAATGGGAAGACGTGGCT
AGCAGCGAGGATGGTAGAGTGACACAACCGGTTGTTTTCATACGACAGCACCCATTCGACAAGAATAAGGCCTAT
GCTCTCGGTGTTGACGGACATCACTTGGTCACCACAGATCAGGCCAAGACGTGGAGATCGTTCGATATAGGCGAC
CAGCCGGCCTTACAGCACCCGCCCCTTGTTTTTCATGGATGGGACTCGAGTAAAGTCATATATCAAAGCGAAGAG
TGTGCCGGGTTCTTCTGCATTGTGAGGTCGTACTACACAACTGATGATTTCAAGACCGTTAGGCTGTTGCGGGAG
AGTGCGGCGGGGTGCTCCTGGGCAGTTGGGCACCCTCACTTCGCCGAAGATATGGATTTGAACCAAGAGTTGAAG
GACAGATCACTGTGTGTCGTCCCTGGGTTGAAGGTGCCCTTTGGACACGCCAACCGCTTGGTATACTCGGATGAT
TACTTCGTTAGTAACATCGAAGGCACAGAGGTGAACTTACATGAGGGCCGGCCTGTCTCCGGCGTCATTAGCACA
GCCGCTGTCAAGAAGTTCATCGTGGCCGCCGTCAAATCCAAAGGAACAGAAGAGCTTGCCTTGTTTGTGACAACG
GATACGAATACCTGGCATCGAGCCGAATTCGATGGACATCGGATAGAGCAGGACGCGTATACAATGTTGGAGAGC
ACCAACTATAGCCTGCAGGTAGACGTCCTGACTAGCCCATCTAGCAACATGGGTGTCCTATTCACTTCCAATTCG
AACGGCACATTCTTCAGCCGTAATATTGAACACACCAATCGCGATATGGAAGGGACTGTCGATTTCGAGAAGATT
GCTGGCATTCAAGGCATAGTTATGGTCAATACGGTGAAAAACCCGAAAGAGGTTAAGTCCGGGCAAGCGAAAAAG
GTCATCAGTAGAATAAGTTTCGATGATGGGCGAAGTTTCCAGCCTCTCAAGGTTGGTGACAAGAATCTACATTTA
CATTCCGTGACTACGTTCGCCAATATCGGCCGGGTATTCTCAAGTCCAGCACCAGGATTAGTCATGGGAATCGGC
AATACAGGTGATCACCTTCAAAAATACAGCGATGGCGATCTTTATATTTCAGACGATGCTGGTGTGACTTGGCGT
CATGCCCTTGACGGGCCGCATAAGTACGAATTTGGCGACCAAGGAGCTGTGGTTATGGCAATCAGCGACAAGGGC
AAATCCAACAAGATCAGCTTTTCTCTTGACCATGGCAAAGAATGGGGATCAGTGGAGATCGAACATAAGATATAT
CCTACTATGGTCACAACGACACCGGACTCCACGAGTCTAAGATTTTTACTAGTCGGCAAGCAAAACGAGGAAAGC
GGATTCATTGTCTATTCCATCGACTTCAAGGGATTGCATGAGCGGAAATGCGAAGAAGATGACTTTGAGAAGTGG
CCAGCTAGACTAGACGAAAACGGCGAGCCAGACTGCTTGATGGGTCATAAACAATTCTTCCGCCGCAGAAAGGCG
AATGCTGACTGCTTCGTGGATGAGGAGTTCAAAGATCCTCAGCCGATTATGGAGCCATGCAAATGTACGGCAGAA
GACTTTGAATGTGAATTCAAAGGCAGCGAGGATGGGAAGAGTTGCATCCCGGCCCTACTGCCGGTGCCTCCAGAA
GGGTGCAAGAACCCCGATGATACCTTCATGGGACCGTCTGGTTGGAGACTGATACCAGGTGACACTTGCATCCGT
GATGGCGGTAAGAATCTGGATCACGATGTTGAGTGGCGTTGCAAGGATGCAGGCAATGTACCCACATCTGGCGAA
ATCAGCGTGGAAAAACAATACTTTGATGCAAGGCAATTCAGCGCCTATTATTACCTAGAACGTCAGTCAAGCAGT
TCTGGCAATGACGAGACGATTGTTATGCTCACCAGTGAACGTGCGCTCTATGTATCACATGATCATGGGAAGACA
TGGAAGCAGCCACTGAAAGGAGAAGCTATCAACAGAATCGTTCCTCACCCGTACAACAGTGATGGTGCTTTTCTC
TTGACGGACGGTGCGGAGGGCTTTTGGACTGTTGATCGTGGCCAGTCTTTCAAGCCTTTCGATGCACCAGCGCCT
CCAACTGAAGAACGCCTTCCAACCCTCACGTTCCATCCCCAATATCAAGACTGGCTGATCTGGACAGGGGCTGTT
GATTGCGGATCTGGTGATTGTCACTCCAACGCCTACATCAGTAAAAACCGCGGGGACAATTGGGAGCTGCTGCAA
CGCTATGTTCAAAAGTGTGAATTCGAAAGCAGGGAAGGCCGCAAAGATAGCACGAACCTCATATTCTGCGAGCAA
TTCGAGAATGAGAACAGAAACAACCGACTACAACTGGTATCCAGTAAGAACTGGTTTTCAGACTCGACCGTCCAT
TTCAGAGATGTCATCAACTATGCCACCATGTCCGAGTTCATTGTTGTGGCGTCTCGAGATACAGAAAAGCCAGAC
TCTTTGGTCGCGAGCAGCAGTGTCGATGGTGAGACATTTGCGGAGGCAAAATTTCCTCCAAATGTCAACGTCCCT
GTCCAAACGGCATATACTGTGCTTGAGAGTTCTACTCACGCCGTTTTTCTGCATGTTACAGTAAGTAACTCGGAG
GGGGCCGAGTACGGATCGATTATCAAGAGTAATAGCAACGGAACTTCCTATGTGCTCAGCCTTGGTGCAGTGAAT
CGAAATTTTCGGGGTTATGTCGACTTTGAGAAGATGCAAGGTATAGAAGGCGTGGCAGTTGCAAACGTTGTCAGT
AACGTGAATAAGCTGTCAGATGGGGAGCCGAAAAAGTTAAGGACAATGATTACGCACAATGATGGAGGGCAATGG
ACCTTGCTTTCTCCCCCAAATAAGGATGCAGAGGGCAAGGACTTTGGGTGTTCTGTGGAAGGAGAAGGCGTTCCT
GGCTGTTCGCTCCACCTTCACGGCTATACAGAACGTAGGGATGAGCGGGACACGTTTTCGTCCAGTTCAGCAATC
GGCTTGATGCTCGGAGTCGGCAACGTTGGTGACCACCTCGGTGGCGAAGACGAAGCCGATACGTTCATAACCCGG
GATGCTGGCTTCACATGGAAGTCGGTCAAGAAGGGCAGGTACATCTGGGAGTTTGGTGATGCCGGCTCCTTGATT
GTGATCGTGCCTGAGTCGAAGCCGACCAAAACTCTTTACTACAGCCTTGACGAGGGAGACACGTGGTTAGACTTT
GTCTTCTCGGACGTGGAGATGCAGATTGATGATATCTCCACCGTACCGTCCGACACGTCCAAGAGCTTTCTTCTC
TGGGGCAAAGAATTGAAATCGGATTACCAAGATAAGCTCGCGACAGTAAGTGTTGACTTCAGTGGGCTCCGTTCC
TCCTCGTGTAAATTGGACGAAAATAGTGCCGAGAGCCATGATTATTACCTCTGGGAACCGAAGCATCCGTTCCAA
AGTGATAATTGCCTGTTTGGTCATGTTGAGCAATATCATCGGAAGAAACCGTCAGCCCAATGTTGGAACGACTGG
CGTGAACCTCATGTTCACAGTATCGGAGAGAACTGCCCCTGTACAAGGGCTGACTTTGAATGGTAAGTATTCCCC
GTCAACTGCCCTCCCTTAACTTTCATTAAGCGCTACTTTATACTTGTAAATGGTGCAATTACTGATCCAGATGCA
GTGACTACAACTACGAGCCTCAGAGTGATGGCAGCTGTGCCCTTGTTCAAGGACTCGCTCCTCCTGATGCCATGG
CTGTATGCAGAGAAGACCCTGAAGCATATCAATATTGGGAACCCTCAGGATATCGGCGTCTCCCCCAATCAACGT
GTCAGGGTGGACGGGAAATGGATCATATTGTTTCCAAGCCTTGCCCAAACAGAGAGGAAGAGTATAAGAAGAAGC
ATGGGATAAGCGGCGCAGGTCTCTTCTTCGCGATCGTCATCCCTATTGCTGTAGCAAGCGCTGTCGGTTACTATG
GCTATACTAGGTGGGACGGCAAGTTTGGCCAAATTCGGCTTGGAGAGAATGTTGGTACCTCCCAGGGTCTGCTTT
CGCGAGATTCTCTGCTCATCACCATCCCGGTTACCATAATTGCGGGTGCGGTGGCCGTCATAAAGGCTCTCCCAC
TGTTAGCTACAAGTCTCTGGCGGAGCGCGAGCGGATATGTGCGCCTAGGACGCAACCGGGGCTACTCCAGGCCTT
ATGCGTCTCGCGGATCATTTGCCGCCAGGCGCGGCGACTACACTGGTGTTGTTGATGACGAGGATGAGCTTCTTG
GTGTGGAAGATCTCGAAGCGGATGAAGAGGAAGAGCTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail