Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g9399.t1
Gene name
Locationscaffold_101:58639..60564
Strand-
Gene length (bp)1925
Transcript length (bp)1650
Coding sequence length (bp)1650
Protein length (aa) 550

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13520 AA_permease_2 Amino acid permease 1.2E-91 50 484
PF00324 AA_permease Amino acid permease 3.1E-16 63 459

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016020 membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0006810 transport No
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.45

Transmembrane Domains

Domain # Start End Length
1 50 72 22
2 82 104 22
3 135 157 22
4 172 194 22
5 199 221 22
6 241 263 22
7 276 298 22
8 328 347 19
9 373 395 22
10 405 427 22
11 439 461 22
12 476 498 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g9399.t1
MTDPVVESAYQKGILPDAKAVEEGPRRTDGVSGLYEGNVFEATPDDRRQIGVISASFLIFNRVIGTGIFATPSTI
LSLSGSVGLSLIMWVIGTLIAMAGTAVYLEWGTAIPKNGGEKNYLEYVFKKPKFLMTAMYAAYAVLLGWAASNSV
VFGEYILNAADIEVDRWNQRGIGLACITAAFLIHSFAVKWGLMLQNFLGVVKLVIILFVIVAGWVALGGHMKIDP
PHNFTNAFEGTTDTGYGIVMALYNVIWSFIGYSNANYALSETKNPTRTLKIAAPIAIISVGIMYMLCNIAYFAAV
PKEQFLSSGQTVAAAFFGNMFGARAEKVMSVFVALSAFGNVLSVIFSQGRIVQALGREGVLPLSKIWASNRPFNS
PAAGLFEHWVVSVIIMLAPPPGDAYNFLVNLISYPLSIVNVFVSGGLIYIYLTKEKNFPDWSPGIRATLPVTIFF
CLSNMYLVVAPYVPPSAGQSVYNSLPYYLHCVVALGIFALGAIYYLVWAVLMPRFGRYILVKESVVDADGWSRSV
FTKMPIEQAEALRHEGQQQGEHHF*
Coding >Ani_SJS72_1|g9399.t1
ATGACGGACCCAGTTGTGGAATCTGCGTATCAAAAGGGCATCCTGCCCGACGCCAAGGCTGTCGAGGAAGGCCCT
CGTCGAACGGATGGCGTTTCCGGTTTGTATGAAGGAAATGTCTTCGAGGCTACCCCGGATGACCGTCGCCAGATT
GGCGTCATCAGTGCCTCCTTTCTGATCTTCAACCGTGTCATTGGTACTGGTATCTTCGCTACCCCGAGTACTATC
CTGTCTTTGTCGGGTAGTGTTGGTCTGTCTCTGATCATGTGGGTCATTGGTACCTTGATTGCCATGGCTGGTACT
GCTGTTTATCTGGAATGGGGTACTGCTATTCCTAAGAACGGTGGAGAAAAGAACTACCTCGAATATGTCTTCAAG
AAGCCCAAGTTCCTGATGACGGCCATGTACGCGGCCTATGCAGTCCTGCTGGGTTGGGCCGCCAGTAACAGTGTC
GTCTTTGGCGAGTATATTCTGAACGCGGCGGACATCGAAGTGGATCGCTGGAACCAGCGTGGAATTGGTTTGGCT
TGTATCACCGCTGCCTTCCTCATCCATTCCTTCGCTGTCAAGTGGGGTCTCATGCTTCAGAACTTCCTGGGTGTG
GTCAAGCTGGTCATCATCCTTTTCGTCATCGTCGCCGGATGGGTGGCTCTCGGCGGCCATATGAAGATCGATCCT
CCTCACAACTTCACCAATGCGTTCGAGGGTACCACTGACACCGGCTATGGCATTGTCATGGCGTTGTATAACGTC
ATCTGGTCCTTCATCGGGTACTCCAATGCCAACTACGCCTTGAGCGAGACGAAGAACCCTACCCGTACCCTGAAG
ATCGCCGCCCCCATTGCCATCATCTCCGTCGGTATCATGTACATGCTGTGCAACATCGCATACTTTGCTGCTGTC
CCGAAGGAGCAGTTCCTGTCCTCTGGCCAGACCGTCGCCGCCGCCTTCTTCGGCAACATGTTCGGTGCGCGCGCA
GAGAAGGTGATGTCGGTCTTTGTGGCCCTGTCTGCATTTGGTAATGTTCTGTCGGTCATCTTCTCGCAAGGACGA
ATTGTCCAAGCCCTCGGTCGCGAAGGAGTCCTCCCTCTGTCGAAGATCTGGGCCAGCAACCGGCCGTTCAACTCG
CCCGCCGCTGGCCTCTTCGAGCACTGGGTAGTGTCCGTGATCATCATGTTGGCCCCGCCTCCCGGCGATGCCTAC
AACTTCCTTGTGAACCTGATCTCGTACCCGCTGTCTATCGTCAACGTCTTCGTGTCCGGCGGTCTCATCTACATC
TATCTGACCAAGGAGAAGAACTTCCCGGACTGGTCCCCCGGTATTCGGGCCACACTCCCCGTCACCATCTTCTTC
TGCCTGTCCAACATGTACCTGGTGGTGGCGCCCTACGTGCCCCCCAGTGCCGGACAGAGCGTCTACAACAGCCTG
CCTTACTACCTGCACTGTGTGGTGGCGCTGGGCATTTTCGCCCTCGGCGCTATTTACTATCTAGTCTGGGCGGTG
CTGATGCCTCGCTTTGGTCGCTATATCCTTGTGAAGGAGTCGGTCGTGGATGCTGATGGCTGGTCCAGAAGTGTC
TTTACAAAGATGCCGATTGAGCAGGCTGAGGCTTTGAGGCATGAAGGGCAGCAGCAGGGAGAGCACCATTTCTGA
Transcript >Ani_SJS72_1|g9399.t1
ATGACGGACCCAGTTGTGGAATCTGCGTATCAAAAGGGCATCCTGCCCGACGCCAAGGCTGTCGAGGAAGGCCCT
CGTCGAACGGATGGCGTTTCCGGTTTGTATGAAGGAAATGTCTTCGAGGCTACCCCGGATGACCGTCGCCAGATT
GGCGTCATCAGTGCCTCCTTTCTGATCTTCAACCGTGTCATTGGTACTGGTATCTTCGCTACCCCGAGTACTATC
CTGTCTTTGTCGGGTAGTGTTGGTCTGTCTCTGATCATGTGGGTCATTGGTACCTTGATTGCCATGGCTGGTACT
GCTGTTTATCTGGAATGGGGTACTGCTATTCCTAAGAACGGTGGAGAAAAGAACTACCTCGAATATGTCTTCAAG
AAGCCCAAGTTCCTGATGACGGCCATGTACGCGGCCTATGCAGTCCTGCTGGGTTGGGCCGCCAGTAACAGTGTC
GTCTTTGGCGAGTATATTCTGAACGCGGCGGACATCGAAGTGGATCGCTGGAACCAGCGTGGAATTGGTTTGGCT
TGTATCACCGCTGCCTTCCTCATCCATTCCTTCGCTGTCAAGTGGGGTCTCATGCTTCAGAACTTCCTGGGTGTG
GTCAAGCTGGTCATCATCCTTTTCGTCATCGTCGCCGGATGGGTGGCTCTCGGCGGCCATATGAAGATCGATCCT
CCTCACAACTTCACCAATGCGTTCGAGGGTACCACTGACACCGGCTATGGCATTGTCATGGCGTTGTATAACGTC
ATCTGGTCCTTCATCGGGTACTCCAATGCCAACTACGCCTTGAGCGAGACGAAGAACCCTACCCGTACCCTGAAG
ATCGCCGCCCCCATTGCCATCATCTCCGTCGGTATCATGTACATGCTGTGCAACATCGCATACTTTGCTGCTGTC
CCGAAGGAGCAGTTCCTGTCCTCTGGCCAGACCGTCGCCGCCGCCTTCTTCGGCAACATGTTCGGTGCGCGCGCA
GAGAAGGTGATGTCGGTCTTTGTGGCCCTGTCTGCATTTGGTAATGTTCTGTCGGTCATCTTCTCGCAAGGACGA
ATTGTCCAAGCCCTCGGTCGCGAAGGAGTCCTCCCTCTGTCGAAGATCTGGGCCAGCAACCGGCCGTTCAACTCG
CCCGCCGCTGGCCTCTTCGAGCACTGGGTAGTGTCCGTGATCATCATGTTGGCCCCGCCTCCCGGCGATGCCTAC
AACTTCCTTGTGAACCTGATCTCGTACCCGCTGTCTATCGTCAACGTCTTCGTGTCCGGCGGTCTCATCTACATC
TATCTGACCAAGGAGAAGAACTTCCCGGACTGGTCCCCCGGTATTCGGGCCACACTCCCCGTCACCATCTTCTTC
TGCCTGTCCAACATGTACCTGGTGGTGGCGCCCTACGTGCCCCCCAGTGCCGGACAGAGCGTCTACAACAGCCTG
CCTTACTACCTGCACTGTGTGGTGGCGCTGGGCATTTTCGCCCTCGGCGCTATTTACTATCTAGTCTGGGCGGTG
CTGATGCCTCGCTTTGGTCGCTATATCCTTGTGAAGGAGTCGGTCGTGGATGCTGATGGCTGGTCCAGAAGTGTC
TTTACAAAGATGCCGATTGAGCAGGCTGAGGCTTTGAGGCATGAAGGGCAGCAGCAGGGAGAGCACCATTTCTGA
Gene >Ani_SJS72_1|g9399.t1
ATGACGGACCCAGTTGTGGAATCTGCGTATCAAAAGGGCATCCTGCCCGACGCCAAGGCTGTCGAGGAAGGCCCT
CGTCGAACGGATGGCGTTTCCGGTTTGTGTATGTGTGACTGTCCCATCTCCTCCCAGGTCTCTCCCAAGGTTTCC
CGGCATAGTGATGAAGAATCCGCCCTGACTGTTTCGAAACTAGATGAAGGAAATGTCTTCGAGGCTACCCCGGAT
GACCGTCGCCAGATTGGCGTCATCAGTGCCTCCTTTCTGATCTTCAACCGTGTCATTGGTACTGGTATCTTCGCT
ACCCCGAGTACTATCCTGTCTTTGTCGGGTAGTGTTGGTCTGTCTCTGATCATGTGGGTCATTGGTACCTTGATT
GCCATGGCTGGTACTGCTGTTTATCTGGAATGGGGTACTGCTATTCCTAAGTATGCTTTATCCTGAACGGTTGGG
GTAGGTAGAACTTGAGGCTAATGACTTCTCATAGGAACGGTGGAGAAAAGAACTACCTCGAATATGTCTTCAAGA
AGCCCAAGTTCCTGATGACGGCCATGTACGCGGCCTATGCAGTCCTGCTGGGTTGGGCCGCCAGTAACAGTGTCG
TCTTTGGCGAGTATATTCTGAACGCGGCGGACATCGAAGTGGATCGCTGGAACCAGCGTGGAATTGGTTTGGCTT
GTATCACCGCTGCCTTCCTCATCCATTCCTTCGCTGTCAAGTGGGGTCTCATGCTTCAGAACTTCCTGGGTGTGG
TCAAGCTGGTCATCATCCTTTTCGTCATCGTCGCCGGATGGGTGGCTCTCGGCGGCCATATGAAGATCGATCCTC
CTCACAACTTCACCAATGCGTTCGAGGGTACCACTGACACCGGCTATGGCATTGTCATGGCGTTGTATAACGTCA
TCTGGTCCTTCATCGGGTACTCCAATGCCAACTACGTATGTTGTTCTGACTGTGTACGTGGTCTGTGATAGGTTG
CTAATATTGTTGTGTGCAGGCCTTGAGCGAGACGAAGAACCCTACCCGTACCCTGAAGATCGCCGCCCCCATTGC
CATCATCTCCGTCGGTATCATGTACATGCTGTGCAACATCGCATACTTTGCTGCTGTCCCGAAGGAGCAGTTCCT
GTCCTCTGGCCAGACCGTCGCCGCCGCCTTCTTCGGCAACATGTTCGGTGCGCGCGCAGAGAAGGTGATGTCGGT
CTTTGTGGCCCTGTCTGCATTTGGTAATGTTCTGTCGGTCATCTTCTCGCAAGGACGAAGTACGTACATACCATT
CCTTCCCTACATCGCGTCAAACGTCGAGCGAAGCTAATATTATGATAACAGTTGTCCAAGCCCTCGGTCGCGAAG
GAGTCCTCCCTCTGTCGAAGATCTGGGCCAGCAACCGGCCGTTCAACTCGCCCGCCGCTGGCCTCTTCGAGCACT
GGGTAGTGTCCGTGATCATCATGTTGGCCCCGCCTCCCGGCGATGCCTACAACTTCCTTGTGAACCTGATCTCGT
ACCCGCTGTCTATCGTCAACGTCTTCGTGTCCGGCGGTCTCATCTACATCTATCTGACCAAGGAGAAGAACTTCC
CGGACTGGTCCCCCGGTATTCGGGCCACACTCCCCGTCACCATCTTCTTCTGCCTGTCCAACATGTACCTGGTGG
TGGCGCCCTACGTGCCCCCCAGTGCCGGACAGAGCGTCTACAACAGCCTGCCTTACTACCTGCACTGTGTGGTGG
CGCTGGGCATTTTCGCCCTCGGCGCTATTTACTATCTAGTCTGGGCGGTGCTGATGCCTCGCTTTGGTCGCTATA
TCCTTGTGAAGGAGTCGGTCGTGGATGCTGATGGCTGGTCCAGAAGTGTCTTTACAAAGATGCCGATTGAGCAGG
CTGAGGCTTTGAGGCATGAAGGGCAGCAGCAGGGAGAGCACCATTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail