Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g9382.t1
Gene name
Locationscaffold_101:10531..12450
Strand-
Gene length (bp)1919
Transcript length (bp)1710
Coding sequence length (bp)1710
Protein length (aa) 570

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.7E-36 68 468
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 5.6E-09 62 323

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0006810 transport No
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

Domain # Start End Length
1 61 83 22
2 129 148 19
3 153 175 22
4 187 209 22
5 219 236 17
6 257 279 22
7 289 306 17
8 326 348 22
9 363 385 22
10 392 414 22
11 424 446 22
12 523 545 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g9382.t1
MAMNPEAIELSEAPQSGANSMKLQQALVNRVSGTSILQSHEAKPEAESEPDETLYPHGMQFVLISMSLCFCVFLV
GLDATILTTAVPRITDEFGSVADVGWYDAAFRLTSCMSQLSQGKLYDNYPVKWVFLVNLLLFEGGILLSGLAPSS
MIFIIGRAITGLGFSGISQGCMVIIAISTPLRRRPTFVGLISASEYTAIAIAPILGGILTSDLSWRWCFYINVPA
AALPSAVLLLLKLPNITPRGSKTHIQKLRELDLLGFFLFAPAVLCLLLALQWGGDTYSWTNRRIIALLVLSPIIF
TGFCLLQHRKQDTAMLPPRVLRKRIIITGAAFSLCLSACRAIVQYYLSIWFQTVRNATPLQSGLNTLPLVISVLV
SAITGGWLISRTRTYTPILLPASLLVIAGIALMTTFTPTTPAKLWIPSLILLGLGSGSAVGVPFIAVQAILPMKD
ISIGMALMTFSQDIGEAVFISVAQAIFLNRLTGDLAKSVPGLDPVMVTHLGATSLEGKLPGKYLEAVVGAYDVAV
RGTFLLAVALAGSVFVAAVLVKRNPFKVGNELGEGDREERSRGV*
Coding >Ani_SJS72_1|g9382.t1
ATGGCAATGAACCCAGAGGCCATCGAGCTCTCGGAAGCTCCACAGTCTGGGGCGAATTCCATGAAGCTTCAGCAG
GCTCTAGTGAACAGAGTCAGCGGCACTAGCATCCTGCAGAGCCATGAAGCTAAGCCTGAAGCTGAGTCCGAGCCC
GATGAGACCCTCTATCCCCATGGGATGCAATTCGTCCTCATCTCCATGTCCCTTTGTTTCTGTGTCTTCCTGGTT
GGTCTAGATGCCACGATTTTGACCACTGCCGTCCCGCGAATAACCGATGAGTTCGGGTCGGTGGCTGATGTTGGT
TGGTATGATGCTGCTTTCCGACTCACCTCCTGCATGTCTCAGCTCTCCCAGGGAAAGTTGTATGACAACTATCCG
GTCAAATGGGTCTTTCTCGTCAACCTCCTGCTGTTCGAGGGCGGCATCCTTCTCTCGGGACTGGCCCCGAGTTCA
ATGATCTTCATCATTGGAAGAGCTATAACCGGCTTAGGATTTTCGGGGATCAGCCAAGGGTGCATGGTCATCATT
GCAATTTCCACGCCGCTACGAAGGCGACCGACCTTCGTCGGCCTAATCAGCGCCAGCGAATACACTGCCATCGCG
ATAGCACCTATTCTGGGAGGTATACTCACATCTGACCTATCCTGGAGATGGTGTTTCTACATCAACGTGCCTGCA
GCAGCCCTACCATCCGCCGTGCTTCTCCTTCTTAAGCTTCCCAACATTACCCCCAGGGGCTCGAAAACACACATT
CAGAAACTCCGCGAGCTGGACCTACTCGGATTCTTCCTCTTCGCACCCGCAGTGCTATGCCTCCTCCTCGCGCTC
CAATGGGGCGGTGATACCTACAGCTGGACCAACAGACGGATCATCGCCCTTCTCGTCCTCTCGCCCATCATCTTC
ACGGGTTTCTGTCTCCTCCAGCACCGCAAACAAGATACCGCCATGCTCCCACCCCGCGTCCTCCGTAAACGCATC
ATAATCACCGGCGCGGCCTTCAGCCTGTGTCTCTCGGCCTGCCGCGCCATCGTCCAGTACTACCTCTCAATCTGG
TTCCAAACCGTCCGCAACGCCACCCCCCTCCAAAGCGGCCTCAACACCCTCCCCCTAGTCATCTCCGTCCTCGTC
AGCGCCATCACTGGCGGATGGCTCATCTCCCGCACACGCACCTACACCCCGATCCTCCTTCCTGCCTCCCTCCTC
GTTATCGCCGGCATCGCTCTCATGACAACCTTCACCCCCACCACGCCCGCCAAGCTCTGGATCCCATCTCTTATC
CTCCTAGGCCTCGGATCCGGCAGCGCCGTCGGTGTACCCTTCATCGCCGTGCAGGCCATTCTCCCCATGAAGGAC
ATTTCCATAGGCATGGCACTGATGACTTTCTCGCAGGACATCGGAGAAGCGGTGTTCATCAGTGTGGCGCAGGCG
ATTTTCTTGAACCGGTTGACGGGGGATTTAGCGAAGAGTGTGCCCGGACTGGATCCGGTAATGGTGACCCATTTG
GGCGCCACAAGTTTGGAGGGTAAGTTGCCCGGGAAGTACTTGGAGGCGGTGGTGGGGGCGTATGATGTTGCGGTG
AGGGGGACGTTCTTGCTGGCGGTTGCGTTGGCGGGGAGTGTGTTTGTGGCGGCGGTTTTGGTAAAGCGGAATCCG
TTCAAGGTTGGCAATGAGTTGGGGGAGGGAGATAGAGAAGAGAGAAGCAGGGGAGTGTAA
Transcript >Ani_SJS72_1|g9382.t1
ATGGCAATGAACCCAGAGGCCATCGAGCTCTCGGAAGCTCCACAGTCTGGGGCGAATTCCATGAAGCTTCAGCAG
GCTCTAGTGAACAGAGTCAGCGGCACTAGCATCCTGCAGAGCCATGAAGCTAAGCCTGAAGCTGAGTCCGAGCCC
GATGAGACCCTCTATCCCCATGGGATGCAATTCGTCCTCATCTCCATGTCCCTTTGTTTCTGTGTCTTCCTGGTT
GGTCTAGATGCCACGATTTTGACCACTGCCGTCCCGCGAATAACCGATGAGTTCGGGTCGGTGGCTGATGTTGGT
TGGTATGATGCTGCTTTCCGACTCACCTCCTGCATGTCTCAGCTCTCCCAGGGAAAGTTGTATGACAACTATCCG
GTCAAATGGGTCTTTCTCGTCAACCTCCTGCTGTTCGAGGGCGGCATCCTTCTCTCGGGACTGGCCCCGAGTTCA
ATGATCTTCATCATTGGAAGAGCTATAACCGGCTTAGGATTTTCGGGGATCAGCCAAGGGTGCATGGTCATCATT
GCAATTTCCACGCCGCTACGAAGGCGACCGACCTTCGTCGGCCTAATCAGCGCCAGCGAATACACTGCCATCGCG
ATAGCACCTATTCTGGGAGGTATACTCACATCTGACCTATCCTGGAGATGGTGTTTCTACATCAACGTGCCTGCA
GCAGCCCTACCATCCGCCGTGCTTCTCCTTCTTAAGCTTCCCAACATTACCCCCAGGGGCTCGAAAACACACATT
CAGAAACTCCGCGAGCTGGACCTACTCGGATTCTTCCTCTTCGCACCCGCAGTGCTATGCCTCCTCCTCGCGCTC
CAATGGGGCGGTGATACCTACAGCTGGACCAACAGACGGATCATCGCCCTTCTCGTCCTCTCGCCCATCATCTTC
ACGGGTTTCTGTCTCCTCCAGCACCGCAAACAAGATACCGCCATGCTCCCACCCCGCGTCCTCCGTAAACGCATC
ATAATCACCGGCGCGGCCTTCAGCCTGTGTCTCTCGGCCTGCCGCGCCATCGTCCAGTACTACCTCTCAATCTGG
TTCCAAACCGTCCGCAACGCCACCCCCCTCCAAAGCGGCCTCAACACCCTCCCCCTAGTCATCTCCGTCCTCGTC
AGCGCCATCACTGGCGGATGGCTCATCTCCCGCACACGCACCTACACCCCGATCCTCCTTCCTGCCTCCCTCCTC
GTTATCGCCGGCATCGCTCTCATGACAACCTTCACCCCCACCACGCCCGCCAAGCTCTGGATCCCATCTCTTATC
CTCCTAGGCCTCGGATCCGGCAGCGCCGTCGGTGTACCCTTCATCGCCGTGCAGGCCATTCTCCCCATGAAGGAC
ATTTCCATAGGCATGGCACTGATGACTTTCTCGCAGGACATCGGAGAAGCGGTGTTCATCAGTGTGGCGCAGGCG
ATTTTCTTGAACCGGTTGACGGGGGATTTAGCGAAGAGTGTGCCCGGACTGGATCCGGTAATGGTGACCCATTTG
GGCGCCACAAGTTTGGAGGGTAAGTTGCCCGGGAAGTACTTGGAGGCGGTGGTGGGGGCGTATGATGTTGCGGTG
AGGGGGACGTTCTTGCTGGCGGTTGCGTTGGCGGGGAGTGTGTTTGTGGCGGCGGTTTTGGTAAAGCGGAATCCG
TTCAAGGTTGGCAATGAGTTGGGGGAGGGAGATAGAGAAGAGAGAAGCAGGGGAGTGTAA
Gene >Ani_SJS72_1|g9382.t1
ATGGCAATGAACCCAGAGGCCATCGAGCTCTCGGAAGCTCCACAGTCTGGGGCGAATTCCATGAAGCTTCAGCAG
GCTCTAGTGAACAGAGTCAGCGGCACTAGCATCCTGCAGAGCCATGAAGCTAAGCCTGAAGCTGAGTCCGAGCCC
GATGAGACCCTCTATCCCCATGGGATGCAATTCGTCCTCATCTCCATGTCCCTTTGTTTCTGTGTCTTCCTGGTT
GGTCTAGTAAGTGCTACTATTTGCCGATTCCCTATACGCTGGTTAAACATGTCAGGATGCCACGATTTTGACCAC
TGCCGTCCCGCGAATAACCGATGAGTTCGGGTCGGTGGCTGATGTTGGTTGGTATGATGCTGCTTTGTGAGTCTA
TCCTACCGATTAGTATCAGCCCTGTACATTCCTGCTAACTCCATCCAAGCCGACTCACCTCCTGCATGTCTCAGC
TCTCCCAGGGAAAGTTGTATGACAACTATCCGGTCAAATGGGTCTTTCTCGTCAACCTCCTGCTGTTCGAGGGCG
GCATCCTTCTCTCGGGACTGGCCCCGAGTTCAATGATCTTCATCATTGGAAGAGCTATAACCGGCTTAGGATTTT
CGGGGATCAGCCAAGGGTGCATGGTGTAAGCACTACATCGCCTGAGCGCGTATTGCAAACTAACAGTCGTCCAGC
ATCATTGCAATTTCCACGCCGCTACGAAGGCGACCGACCTTCGTCGGCCTAATCAGCGCCAGCGAATACACTGCC
ATCGCGATAGCACCTATTCTGGGAGGTATACTCACATCTGACCTATCCTGGAGATGGTGTTTCTACATCAACGTG
CCTGCAGCAGCCCTACCATCCGCCGTGCTTCTCCTTCTTAAGCTTCCCAACATTACCCCCAGGGGCTCGAAAACA
CACATTCAGAAACTCCGCGAGCTGGACCTACTCGGATTCTTCCTCTTCGCACCCGCAGTGCTATGCCTCCTCCTC
GCGCTCCAATGGGGCGGTGATACCTACAGCTGGACCAACAGACGGATCATCGCCCTTCTCGTCCTCTCGCCCATC
ATCTTCACGGGTTTCTGTCTCCTCCAGCACCGCAAACAAGATACCGCCATGCTCCCACCCCGCGTCCTCCGTAAA
CGCATCATAATCACCGGCGCGGCCTTCAGCCTGTGTCTCTCGGCCTGCCGCGCCATCGTCCAGTACTACGTACAC
TCCCCATCTCCATCCTTACCCTATAACACAAACTAACCCAGCAACAGCTCTCAATCTGGTTCCAAACCGTCCGCA
ACGCCACCCCCCTCCAAAGCGGCCTCAACACCCTCCCCCTAGTCATCTCCGTCCTCGTCAGCGCCATCACTGGCG
GATGGCTCATCTCCCGCACACGCACCTACACCCCGATCCTCCTTCCTGCCTCCCTCCTCGTTATCGCCGGCATCG
CTCTCATGACAACCTTCACCCCCACCACGCCCGCCAAGCTCTGGATCCCATCTCTTATCCTCCTAGGCCTCGGAT
CCGGCAGCGCCGTCGGTGTACCCTTCATCGCCGTGCAGGCCATTCTCCCCATGAAGGACATTTCCATAGGCATGG
CACTGATGACTTTCTCGCAGGACATCGGAGAAGCGGTGTTCATCAGTGTGGCGCAGGCGATTTTCTTGAACCGGT
TGACGGGGGATTTAGCGAAGAGTGTGCCCGGACTGGATCCGGTAATGGTGACCCATTTGGGCGCCACAAGTTTGG
AGGGTAAGTTGCCCGGGAAGTACTTGGAGGCGGTGGTGGGGGCGTATGATGTTGCGGTGAGGGGGACGTTCTTGC
TGGCGGTTGCGTTGGCGGGGAGTGTGTTTGTGGCGGCGGTTTTGGTAAAGCGGAATCCGTTCAAGGTTGGCAATG
AGTTGGGGGAGGGAGATAGAGAAGAGAGAAGCAGGGGAGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail