Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g8979.t1
Gene name
Locationscaffold_090:66619..68315
Strand-
Gene length (bp)1696
Transcript length (bp)1521
Coding sequence length (bp)1521
Protein length (aa) 507

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03062 MBOAT MBOAT, membrane-bound O-acyltransferase family 2.2E-23 251 483

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 82 101 19
2 123 145 22
3 182 204 22
4 208 230 22
5 261 280 19
6 295 317 22
7 344 366 22
8 410 432 22
9 437 459 22
10 474 496 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g8979.t1
MSPTQEASHSPGTAVSTGTDIPTSPQKPMNGKASNGHPPKGTNGATKTNWRRRSKYRHVEAYHSKIRHSSLSREP
NVTTSFLGFRNLMVIVLVAMNLRLIIENFMKYGVLICIRCHDYRRQDVVLGSALFALVPFHLYVSYLIELAAARQ
AKKIVGQKKKDGSTEAPETEQRIFKNTWWISAFFHCVNTLLSLGITSFVVYFYVHHPGIGTLCELQALIVSFKIC
SYAFTNRDLREAMLNPSVESALPEIYSTCPYPNNITLGNLIYFWLAPTLVYQPVYPRTSHIRWSFVAKRLSEFFC
LAVFIWLLSAQYAAPVLRNSIDKIAVMDIASILERVMKLSTISLIIWLAGFFALFQSLLNALAEVMRFGDREFYT
DWWNSSSLGVYWRSWNRPVYLFMKRHVYSPLVGRGWHPLAASTVVFALSAVLHEVLVGIPTHNLIGVAFAGMMFQ
LPLIIITAPLEKIQDPTGKVIGNSIFWVSFCLVGQPLGALLYFFAWQAKYGSVSRM*
Coding >Ani_SJS72_1|g8979.t1
ATGTCTCCTACCCAAGAGGCGTCACATAGCCCTGGTACTGCTGTCAGTACTGGGACTGACATCCCCACATCCCCG
CAAAAGCCCATGAACGGGAAAGCTTCCAACGGTCATCCTCCCAAAGGGACGAATGGCGCCACCAAGACCAACTGG
AGAAGGAGAAGCAAATATCGTCATGTGGAAGCCTATCATTCGAAAATTCGGCATTCCAGTCTCAGTCGCGAACCC
AACGTCACGACGAGTTTCCTGGGCTTCCGAAATCTTATGGTCATAGTGTTGGTCGCAATGAACCTCCGGCTCATC
ATTGAGAACTTCATGAAATATGGTGTCTTAATCTGCATCAGGTGCCACGATTATCGAAGGCAGGATGTTGTGCTC
GGCTCCGCTCTCTTTGCCCTCGTCCCATTCCACCTCTACGTCTCCTATCTCATAGAGCTGGCTGCGGCACGGCAG
GCAAAGAAGATTGTTGGCCAGAAGAAAAAGGATGGTTCGACCGAGGCACCTGAGACCGAACAGCGCATCTTCAAA
AACACATGGTGGATCTCTGCATTCTTCCACTGCGTGAACACCCTTCTGAGTTTGGGAATTACGAGCTTTGTCGTG
TATTTCTACGTTCACCACCCGGGCATTGGCACCCTTTGCGAGCTTCAAGCTCTTATTGTGTCGTTCAAGATTTGT
TCGTATGCCTTCACCAATCGCGACCTCCGCGAGGCCATGCTCAACCCTTCTGTCGAGTCCGCCCTCCCAGAAATC
TATTCGACCTGCCCATACCCCAACAATATCACCTTGGGGAACCTGATCTACTTTTGGTTAGCACCTACGCTAGTC
TATCAGCCGGTATACCCCAGGACGTCACACATCCGGTGGTCGTTCGTGGCCAAACGCCTGTCTGAGTTCTTCTGC
CTAGCCGTATTCATCTGGCTTCTATCTGCTCAGTATGCAGCTCCCGTTTTGCGCAATTCGATCGACAAGATTGCC
GTCATGGATATCGCATCTATTCTGGAGCGCGTGATGAAACTGTCCACCATTTCTCTTATCATCTGGCTGGCGGGG
TTCTTTGCGCTCTTCCAGTCACTGTTGAATGCTTTGGCCGAGGTGATGCGGTTTGGAGACCGTGAATTTTACACT
GATTGGTGGAATAGCTCCAGTCTTGGGGTGTATTGGCGGTCATGGAACCGACCTGTATACCTCTTCATGAAGAGA
CATGTCTATTCGCCGCTTGTTGGTCGTGGGTGGCATCCTCTTGCAGCGAGCACGGTTGTCTTCGCTCTCTCTGCT
GTCTTGCATGAGGTCCTTGTGGGAATTCCCACGCATAACTTGATCGGTGTGGCATTTGCGGGCATGATGTTTCAA
CTACCGCTGATCATTATCACCGCCCCATTAGAGAAGATCCAAGACCCTACTGGGAAGGTGATAGGCAATTCCATT
TTCTGGGTTAGTTTTTGTCTTGTCGGCCAGCCTTTGGGAGCTTTGCTGTACTTCTTTGCCTGGCAAGCGAAGTAT
GGCAGTGTGAGCCGAATGTGA
Transcript >Ani_SJS72_1|g8979.t1
ATGTCTCCTACCCAAGAGGCGTCACATAGCCCTGGTACTGCTGTCAGTACTGGGACTGACATCCCCACATCCCCG
CAAAAGCCCATGAACGGGAAAGCTTCCAACGGTCATCCTCCCAAAGGGACGAATGGCGCCACCAAGACCAACTGG
AGAAGGAGAAGCAAATATCGTCATGTGGAAGCCTATCATTCGAAAATTCGGCATTCCAGTCTCAGTCGCGAACCC
AACGTCACGACGAGTTTCCTGGGCTTCCGAAATCTTATGGTCATAGTGTTGGTCGCAATGAACCTCCGGCTCATC
ATTGAGAACTTCATGAAATATGGTGTCTTAATCTGCATCAGGTGCCACGATTATCGAAGGCAGGATGTTGTGCTC
GGCTCCGCTCTCTTTGCCCTCGTCCCATTCCACCTCTACGTCTCCTATCTCATAGAGCTGGCTGCGGCACGGCAG
GCAAAGAAGATTGTTGGCCAGAAGAAAAAGGATGGTTCGACCGAGGCACCTGAGACCGAACAGCGCATCTTCAAA
AACACATGGTGGATCTCTGCATTCTTCCACTGCGTGAACACCCTTCTGAGTTTGGGAATTACGAGCTTTGTCGTG
TATTTCTACGTTCACCACCCGGGCATTGGCACCCTTTGCGAGCTTCAAGCTCTTATTGTGTCGTTCAAGATTTGT
TCGTATGCCTTCACCAATCGCGACCTCCGCGAGGCCATGCTCAACCCTTCTGTCGAGTCCGCCCTCCCAGAAATC
TATTCGACCTGCCCATACCCCAACAATATCACCTTGGGGAACCTGATCTACTTTTGGTTAGCACCTACGCTAGTC
TATCAGCCGGTATACCCCAGGACGTCACACATCCGGTGGTCGTTCGTGGCCAAACGCCTGTCTGAGTTCTTCTGC
CTAGCCGTATTCATCTGGCTTCTATCTGCTCAGTATGCAGCTCCCGTTTTGCGCAATTCGATCGACAAGATTGCC
GTCATGGATATCGCATCTATTCTGGAGCGCGTGATGAAACTGTCCACCATTTCTCTTATCATCTGGCTGGCGGGG
TTCTTTGCGCTCTTCCAGTCACTGTTGAATGCTTTGGCCGAGGTGATGCGGTTTGGAGACCGTGAATTTTACACT
GATTGGTGGAATAGCTCCAGTCTTGGGGTGTATTGGCGGTCATGGAACCGACCTGTATACCTCTTCATGAAGAGA
CATGTCTATTCGCCGCTTGTTGGTCGTGGGTGGCATCCTCTTGCAGCGAGCACGGTTGTCTTCGCTCTCTCTGCT
GTCTTGCATGAGGTCCTTGTGGGAATTCCCACGCATAACTTGATCGGTGTGGCATTTGCGGGCATGATGTTTCAA
CTACCGCTGATCATTATCACCGCCCCATTAGAGAAGATCCAAGACCCTACTGGGAAGGTGATAGGCAATTCCATT
TTCTGGGTTAGTTTTTGTCTTGTCGGCCAGCCTTTGGGAGCTTTGCTGTACTTCTTTGCCTGGCAAGCGAAGTAT
GGCAGTGTGAGCCGAATGTGA
Gene >Ani_SJS72_1|g8979.t1
ATGTCTCCTACCCAAGAGGCGTCACATAGCCCTGGTACTGCTGTCAGTACTGGGACTGACATCCCCACATCCCCG
CAAAAGCCCATGAACGGGAAAGCTTCCAACGGTCATCCTCCCAAAGGGACGAATGGCGCCACCAAGACCAACTGG
AGAAGGAGAAGCAAATATCGTCATGTGGAAGCCTATCATTCGAAAATTCGGCATTCCAGTCTCAGTCGCGAACCC
AACGTCACGACGAGTTTCCTGGGCTTCCGAAATCTTATGGTCATAGTGTTGGGTTGGCCTCCCCATCCTCCTTGG
CCGTGTGTCCGCTTCTGGCTAATGCTTGGTTTCCGGATCTAGTCGCAATGAACCTCCGGCTCATCATTGAGAACT
TCATGAAAGTAAGCCATGTCTGAGGATCAACATTCAACAATACAAGCCTAGCTGACCTTTTCGGATAGTATGGTG
TCTTAATCTGCATCAGGTGCCACGATTATCGAAGGCAGGATGTTGTGCTCGGCTCCGCTCTCTTTGCCCTCGTCC
CATTCCACCTCTACGTCTCCTATCTCATAGAGCTGGCTGCGGCACGGCAGGCAAAGAAGATTGTTGGCCAGAAGA
AAAAGGATGGTTCGACCGAGGCACCTGAGACCGAACAGCGCATCTTCAAAAACACATGGTGGATCTCTGCATTCT
TCCACTGCGTGAACACCCTTCTGAGTTTGGGAATTACGAGCTTTGTCGTGTATTTCTACGTTCACCACCCGGGCA
TTGGCACCCTTTGCGAGCTTCAAGCTCTTATTGTGTCGTTCAAGATTTGTTCGTATGCCTTCACCAATCGCGACC
TCCGCGAGGCCATGCTCAACCCTTCTGTCGAGTCCGCCCTCCCAGAAATCTATTCGACCTGCCCATACCCCAACA
ATATCACCTTGGGGAACCTGATCTACTTTTGGTTAGCACCTACGCTAGTCTATCAGCCGGTATACCCCAGGACGT
CACACATCCGGTGGTCGTTCGTGGCCAAACGCCTGTCTGAGTTCTTCTGCCTAGCCGTATTCATCTGGCTTCTAT
CTGCTCAGTATGCAGCTCCCGTTTTGCGCAATTCGATCGACAAGATTGCCGTCATGGATATCGCATCTATTCTGG
AGCGCGTGATGAAACTGTCCACCATTTCTCTTATCATCTGGCTGGCGGGGTTCTTTGCGCTCTTCCAGTCACTGT
TGAATGCTTTGGCCGAGGTGATGCGGTTTGGAGACCGTGAATTTTACACTGATTGGTGGAATAGCTCCAGTCTTG
GGGTGTATTGGCGGTCATGGAACCGACCTGTATACCTCTTCATGAAGAGACATGTCTATTCGCCGCTTGTTGGTC
GTGGGTGGCATCCTCTTGCAGCGAGCACGGTTGTCTTCGCTCTCTCTGCTGTCTTGCATGAGGTCCTTGTGGGAA
TTCCCACGCATAACTTGATCGGTATGCATCATTCTCCCGCTTTGTTTTTGGGCCCAAACTAACCGAGTCAGGTGT
GGCATTTGCGGGCATGATGTTTCAACTACCGCTGATCATTATCACCGCCCCATTAGAGAAGATCCAAGACCCTAC
TGGGAAGGTGATAGGCAATTCCATTTTCTGGGTTAGTTTTTGTCTTGTCGGCCAGCCTTTGGGAGCTTTGCTGTA
CTTCTTTGCCTGGCAAGCGAAGTATGGCAGTGTGAGCCGAATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail