Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g8967.t1
Gene name
Locationscaffold_090:28529..29864
Strand-
Gene length (bp)1335
Transcript length (bp)1263
Coding sequence length (bp)1263
Protein length (aa) 421

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00226 DnaJ DnaJ domain 1.4E-24 27 89
PF01556 DnaJ_C DnaJ C terminal domain 3.3E-23 136 377
PF00684 DnaJ_CXXCXGXG DnaJ central domain 2.1E-18 162 225

GO

GO Term Description Terminal node
GO:0051082 unfolded protein binding Yes
GO:0031072 heat shock protein binding Yes
GO:0003674 molecular_function No
GO:0005515 protein binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 7 24 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g8967.t1
MFPTMRTVALFVVLTICLIQLVLAAEDYYKILGLDKSASEKDIKRAYRHLSKKFHPDKNPGDETAQKRFVEIAEA
YDVLSTSSTRKIYDQYGHEGLEQHRQGGRQSHDPFDLFSRFFGGGGHFGHAPGHRRGPDMELRVGLPLRDFYNGR
EFSFGVEKQQICDACEGTGSADREVVTCDKCSGRGIVIQKHQLAPGMFQQVQMHCDKCGGQGKMIKKPCPVCHGH
RVVRREVETHATVEPGMDKGMRLVYENEADESPDWIAGDLVLILEEKEPELGDAEEHRTDGTFFRRKGKDLFWKE
ALSLREAWMGEWTRNITHLDGHVVQLGRKRGEVVQPLSVETIKGEGMPHYSDGHLHDNEDEDEEPGNLYVEYAVI
LPDEMESGMEKDFFALWEKWRKKNGVDLGRDSGRPMPPPPVKDEL*
Coding >Ani_SJS72_1|g8967.t1
ATGTTCCCCACCATGCGAACCGTGGCCCTCTTCGTGGTCCTCACCATCTGTCTCATCCAATTGGTCCTCGCCGCA
GAAGACTACTACAAGATCCTGGGACTGGATAAATCCGCCTCGGAGAAGGACATTAAACGCGCATACAGACATCTG
AGCAAGAAGTTCCATCCGGATAAGAACCCAGGCGACGAAACGGCCCAAAAGAGATTCGTCGAAATCGCCGAAGCC
TACGACGTCCTCTCCACCTCCTCGACACGCAAGATCTACGACCAATACGGCCACGAAGGACTCGAGCAGCACCGT
CAAGGCGGCCGACAATCGCACGACCCGTTCGACCTATTCTCGAGATTCTTCGGCGGCGGAGGCCACTTCGGCCAT
GCGCCGGGACATCGCAGAGGACCGGACATGGAGCTCCGGGTCGGGTTACCGCTAAGGGATTTCTACAATGGACGG
GAATTCTCGTTCGGTGTGGAGAAGCAGCAGATCTGTGATGCCTGTGAGGGCACAGGGTCCGCGGACCGGGAGGTA
GTCACCTGCGATAAGTGTTCTGGACGCGGAATAGTCATCCAGAAGCATCAGTTAGCGCCGGGCATGTTCCAGCAG
GTGCAGATGCATTGTGATAAGTGTGGCGGACAGGGCAAGATGATCAAGAAGCCGTGTCCCGTATGTCATGGACAT
CGGGTTGTTCGCCGCGAGGTCGAGACGCACGCGACTGTCGAGCCGGGGATGGATAAGGGGATGCGGCTGGTATAC
GAGAACGAGGCGGACGAGAGTCCGGACTGGATCGCGGGCGACTTGGTGCTGATTCTTGAGGAGAAGGAGCCGGAG
CTGGGCGACGCCGAGGAACATCGTACGGATGGGACGTTTTTCCGGCGGAAGGGCAAGGATCTGTTTTGGAAGGAG
GCGCTGTCGCTGCGCGAGGCGTGGATGGGCGAGTGGACGCGCAATATCACGCATTTGGATGGTCATGTGGTTCAG
TTGGGGAGGAAGCGTGGGGAGGTCGTGCAGCCGTTGTCGGTTGAGACGATTAAGGGCGAGGGTATGCCGCATTAC
TCGGATGGGCATCTTCATGATAATGAAGATGAGGATGAGGAGCCTGGGAACTTGTATGTGGAGTATGCCGTTATT
CTGCCGGATGAGATGGAGAGCGGCATGGAGAAGGACTTCTTTGCGCTGTGGGAGAAGTGGCGCAAGAAGAACGGG
GTTGATTTGGGTCGCGATAGTGGTCGGCCTATGCCTCCTCCGCCGGTGAAGGACGAGTTATGA
Transcript >Ani_SJS72_1|g8967.t1
ATGTTCCCCACCATGCGAACCGTGGCCCTCTTCGTGGTCCTCACCATCTGTCTCATCCAATTGGTCCTCGCCGCA
GAAGACTACTACAAGATCCTGGGACTGGATAAATCCGCCTCGGAGAAGGACATTAAACGCGCATACAGACATCTG
AGCAAGAAGTTCCATCCGGATAAGAACCCAGGCGACGAAACGGCCCAAAAGAGATTCGTCGAAATCGCCGAAGCC
TACGACGTCCTCTCCACCTCCTCGACACGCAAGATCTACGACCAATACGGCCACGAAGGACTCGAGCAGCACCGT
CAAGGCGGCCGACAATCGCACGACCCGTTCGACCTATTCTCGAGATTCTTCGGCGGCGGAGGCCACTTCGGCCAT
GCGCCGGGACATCGCAGAGGACCGGACATGGAGCTCCGGGTCGGGTTACCGCTAAGGGATTTCTACAATGGACGG
GAATTCTCGTTCGGTGTGGAGAAGCAGCAGATCTGTGATGCCTGTGAGGGCACAGGGTCCGCGGACCGGGAGGTA
GTCACCTGCGATAAGTGTTCTGGACGCGGAATAGTCATCCAGAAGCATCAGTTAGCGCCGGGCATGTTCCAGCAG
GTGCAGATGCATTGTGATAAGTGTGGCGGACAGGGCAAGATGATCAAGAAGCCGTGTCCCGTATGTCATGGACAT
CGGGTTGTTCGCCGCGAGGTCGAGACGCACGCGACTGTCGAGCCGGGGATGGATAAGGGGATGCGGCTGGTATAC
GAGAACGAGGCGGACGAGAGTCCGGACTGGATCGCGGGCGACTTGGTGCTGATTCTTGAGGAGAAGGAGCCGGAG
CTGGGCGACGCCGAGGAACATCGTACGGATGGGACGTTTTTCCGGCGGAAGGGCAAGGATCTGTTTTGGAAGGAG
GCGCTGTCGCTGCGCGAGGCGTGGATGGGCGAGTGGACGCGCAATATCACGCATTTGGATGGTCATGTGGTTCAG
TTGGGGAGGAAGCGTGGGGAGGTCGTGCAGCCGTTGTCGGTTGAGACGATTAAGGGCGAGGGTATGCCGCATTAC
TCGGATGGGCATCTTCATGATAATGAAGATGAGGATGAGGAGCCTGGGAACTTGTATGTGGAGTATGCCGTTATT
CTGCCGGATGAGATGGAGAGCGGCATGGAGAAGGACTTCTTTGCGCTGTGGGAGAAGTGGCGCAAGAAGAACGGG
GTTGATTTGGGTCGCGATAGTGGTCGGCCTATGCCTCCTCCGCCGGTGAAGGACGAGTTATGA
Gene >Ani_SJS72_1|g8967.t1
ATGTTCCCCACCATGCGAACCGTGGCCCTCTTCGTGGTCCTCACCATCTGTCTCATCCAATTGGTCCTCGCCGCA
GAAGACTACTACAAGATCCTGGGACTGGATAAATCCGCCTCGGAGAAGGACATTAAACGCGCATACAGACATCTG
AGCAAGAAGTTCCATCCGGATAAGAACCCGTTCGTTAACTCCCTCTCCCAAATTTCTTTCTTCTTCTGTTGGTGC
TAATGCTAGAACATTTGTTAAAATAGAGGCGACGAAACGGCCCAAAAGAGATTCGTCGAAATCGCCGAAGCCTAC
GACGTCCTCTCCACCTCCTCGACACGCAAGATCTACGACCAATACGGCCACGAAGGACTCGAGCAGCACCGTCAA
GGCGGCCGACAATCGCACGACCCGTTCGACCTATTCTCGAGATTCTTCGGCGGCGGAGGCCACTTCGGCCATGCG
CCGGGACATCGCAGAGGACCGGACATGGAGCTCCGGGTCGGGTTACCGCTAAGGGATTTCTACAATGGACGGGAA
TTCTCGTTCGGTGTGGAGAAGCAGCAGATCTGTGATGCCTGTGAGGGCACAGGGTCCGCGGACCGGGAGGTAGTC
ACCTGCGATAAGTGTTCTGGACGCGGAATAGTCATCCAGAAGCATCAGTTAGCGCCGGGCATGTTCCAGCAGGTG
CAGATGCATTGTGATAAGTGTGGCGGACAGGGCAAGATGATCAAGAAGCCGTGTCCCGTATGTCATGGACATCGG
GTTGTTCGCCGCGAGGTCGAGACGCACGCGACTGTCGAGCCGGGGATGGATAAGGGGATGCGGCTGGTATACGAG
AACGAGGCGGACGAGAGTCCGGACTGGATCGCGGGCGACTTGGTGCTGATTCTTGAGGAGAAGGAGCCGGAGCTG
GGCGACGCCGAGGAACATCGTACGGATGGGACGTTTTTCCGGCGGAAGGGCAAGGATCTGTTTTGGAAGGAGGCG
CTGTCGCTGCGCGAGGCGTGGATGGGCGAGTGGACGCGCAATATCACGCATTTGGATGGTCATGTGGTTCAGTTG
GGGAGGAAGCGTGGGGAGGTCGTGCAGCCGTTGTCGGTTGAGACGATTAAGGGCGAGGGTATGCCGCATTACTCG
GATGGGCATCTTCATGATAATGAAGATGAGGATGAGGAGCCTGGGAACTTGTATGTGGAGTATGCCGTTATTCTG
CCGGATGAGATGGAGAGCGGCATGGAGAAGGACTTCTTTGCGCTGTGGGAGAAGTGGCGCAAGAAGAACGGGGTT
GATTTGGGTCGCGATAGTGGTCGGCCTATGCCTCCTCCGCCGGTGAAGGACGAGTTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail