Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g8954.t1
Gene name
Locationscaffold_089:118384..121731
Strand+
Gene length (bp)3347
Transcript length (bp)2802
Coding sequence length (bp)2802
Protein length (aa) 934

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13364 BetaGal_dom4_5 Beta-galactosidase jelly roll domain 6.5E-24 610 722
PF13364 BetaGal_dom4_5 Beta-galactosidase jelly roll domain 3.9E-36 780 894
PF01301 Glyco_hydro_35 Glycosyl hydrolases family 35 1.4E-60 1 313
PF10435 BetaGal_dom2 Beta-galactosidase, domain 2 3.5E-48 326 501
PF13363 BetaGal_dom3 Beta-galactosidase, domain 3 1.9E-21 502 578

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH35 7.4E-65 1 315

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID3
Orthogroup8421
Change Orthofinder run
Species Protein ID
Aspergillus niger CBS 112.32 Ani_SJS6_1|g1834.t1
Aspergillus niger CBS 113.50 Ani_SJS3_1|g2381.t1
Aspergillus niger CBS 115988 Ani_SJS16_1|g5730.t1
Aspergillus niger CBS 115989 Ani_SJS83_1|g1973.t1
Aspergillus niger CBS 118.52 Ani_SJS14_1|g5988.t1
Aspergillus niger CBS 124.48 Ani_SJS7_1|g7419.t1
Aspergillus niger CBS 131.52 Ani_SJS8_1|g704.t1
Aspergillus niger CBS 133816 Ani_SJS71_1|g7531.t1
Aspergillus niger CBS 147320 Ani_SJS28_1|g2416.t1
Aspergillus niger CBS 147321 Ani_SJS30_1|g3323.t1
Aspergillus niger CBS 147322 Ani_SJS35_1|g1060.t1
Aspergillus niger CBS 147323 Ani_SJS38_1|g10361.t1
Aspergillus niger CBS 147324 Ani_SJS39_1|g8181.t1
Aspergillus niger CBS 147343 Ani_SJS115_1|g6907.t1
Aspergillus niger CBS 147344 Ani_SJS70_1|g10886.t1
Aspergillus niger CBS 147345 Ani_SJS72_1|g8954.t1 (this protein)
Aspergillus niger CBS 147346 Ani_SJS75_1|g5057.t1
Aspergillus niger CBS 147347 Ani_SJS76_1|g10195.t1
Aspergillus niger CBS 147352 Ani_SJS95_1|g2851.t1
Aspergillus niger CBS 147353 Ani_SJS100_1|g8204.t1
Aspergillus niger CBS 147371 Ani_SJS27_1|g690.t1
Aspergillus niger CBS 147482 Ani_SJS55_1|g4589.t1
Aspergillus niger CBS 630.78 Ani_SJS18_1|g8432.t1
Aspergillus niger CBS 769.97 Ani_SJS82_1|g3837.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g8954.t1
MWLDVLQKLKANGFNTISVYFFWSYHSASKDAYDFKTGAHNIQRLFDMAKQAGLWVIARPGPYVNAQTNAGGLAL
WGSDGSMGKLRTSDEAFHQAWLPYMRKVGQIIAANQITRGGPVILCQVENELQETTHEPNNTLVTYMEQLEAVIR
DAGITVPTTHNEKGMRYVSWSRDYGNVGGAVDIYGLDTYPAGFLVGNRCDGATGFNVVRTYYQWFMNYSWTGPIY
LAEFEGGRTLTWGAPQNYDDCRSEHSTTFVDIYYKNNIGQRVTLQSIYEGYGGTNWGHSASPVAYTSNDYMTPLR
ETREQWAKLWQTKLIQLFSGSAPDLLKTYMYGNGSGYSLSTLDAYSWVLKNPDTQATFTVLQQNETPSTTTIAFS
AYLNTSLGNMTVPDIQLQGRQSKILVTDYMFGNQTLLYSSTDVLTNAILPGHDVLALYLWEGQTGEFALKTPRNL
TLQVYGASIVSSTLHPGYQKIKYTQATGSTVLRFTNGVIVLLLDQTTAWHFWAPSTSNYPSPRPDQKLFILGPYL
VRSASVENEVLQVSGDNNGTTTLESFIGDVPIKAIEWNGQRLTATKTPYGSYTAQIPGTEHRSVNLPSLNHWRSA
DSLPEAQPGYDDSRWTVANKNSTLSPQAPLTLPVLFSSDYGYYAGAKIYRGYFDGTNHTAVNITASGGLAFGWNA
WLNGHLIGGHTGDPNLSATNMTLTLPGPHLRTMNNVITVIVDYHGHDETNIANGAGNPRGILGAYLLPGGTRPAT
GFKLWKIQGNAGGAKNIDPVRGPMNEGGLYAERLGWFLPGFPASDNKEFNSTSSPLDGISKPGVRFYVTAFDLDI
DRDLDAPIGVSFSAPNGTIARVMLWVNGYQYGKYVPHIGPQTKFPVPPGIINNRGQNTLALSLWAQTNDGAKLDT
VELFTYGLYQTDFQFDRDWSYLQPGWEGRSVYA*
Coding >Ani_SJS72_1|g8954.t1
ATGTGGCTGGATGTGCTGCAAAAGCTGAAGGCAAATGGCTTCAATACAATCAGTGTGTACTTCTTTTGGAGTTAT
CATTCGGCTTCCAAGGACGCATATGACTTTAAAACGGGAGCACATAACATACAGCGTCTCTTCGACATGGCCAAG
CAGGCGGGCCTATGGGTAATTGCGCGGCCGGGTCCTTATGTCAATGCACAGACAAATGCTGGTGGTTTAGCTCTA
TGGGGCTCTGATGGCTCCATGGGCAAATTGCGGACATCAGATGAGGCCTTTCATCAAGCGTGGCTTCCATATATG
AGGAAAGTCGGACAGATCATTGCAGCGAACCAGATCACAAGAGGTGGTCCCGTTATACTCTGCCAGGTAGAAAAC
GAACTCCAAGAGACCACTCATGAGCCAAACAATACTCTGGTTACGTATATGGAGCAGCTCGAGGCAGTCATTAGA
GATGCTGGGATAACCGTTCCTACGACTCATAACGAAAAAGGCATGAGATATGTATCCTGGTCAAGGGATTACGGA
AACGTTGGTGGCGCTGTCGACATTTATGGCTTGGACACCTACCCTGCAGGATTTCTTGTCGGGAACAGATGTGAT
GGAGCCACTGGATTCAATGTTGTTCGGACCTACTATCAGTGGTTCATGAACTATTCATGGACTGGTCCCATTTAT
CTCGCTGAGTTTGAGGGCGGGCGTACTTTGACCTGGGGTGCTCCACAGAATTATGATGATTGTCGAAGCGAGCAC
AGCACCACCTTTGTGGACATCTACTATAAGAACAACATCGGTCAGCGCGTGACGCTACAAAGCATATATGAAGGC
TATGGGGGGACTAATTGGGGCCATTCTGCTTCCCCAGTGGCATATACTAGCAATGACTATATGACCCCCCTCCGA
GAAACTCGCGAGCAATGGGCCAAGCTTTGGCAAACGAAGCTCATACAACTCTTCTCGGGATCTGCACCTGATTTA
CTCAAGACGTACATGTATGGGAACGGATCGGGTTACAGTCTTTCGACACTCGACGCTTATAGTTGGGTCCTGAAG
AACCCAGATACTCAGGCAACCTTCACTGTGCTGCAGCAGAACGAAACCCCATCAACCACTACCATTGCGTTTTCG
GCCTACTTGAACACCAGCCTTGGCAACATGACTGTTCCAGATATCCAGCTTCAAGGGCGACAGAGCAAGATTCTA
GTTACAGACTACATGTTTGGTAATCAAACACTTCTGTATTCATCAACAGATGTACTTACAAATGCCATCTTGCCC
GGACACGATGTTCTGGCTCTGTATCTATGGGAAGGTCAAACCGGCGAGTTCGCTCTCAAGACGCCAAGGAATTTG
ACGCTCCAGGTATATGGCGCGTCTATCGTGTCGTCCACACTTCATCCTGGCTACCAGAAGATTAAGTACACACAG
GCTACTGGCTCTACTGTCCTTCGTTTTACAAATGGGGTCATTGTCCTATTGCTCGATCAAACAACAGCATGGCAT
TTCTGGGCTCCGTCAACATCAAACTACCCTTCTCCTAGGCCAGACCAGAAGCTTTTCATTCTTGGTCCGTACCTC
GTCCGGTCTGCATCAGTCGAAAATGAAGTGCTTCAGGTCTCTGGAGACAATAACGGAACTACAACCCTGGAGAGC
TTCATCGGCGACGTGCCCATCAAAGCAATCGAGTGGAACGGCCAGCGACTCACAGCAACCAAGACGCCCTATGGC
TCCTACACAGCCCAAATCCCCGGTACAGAACACCGATCAGTAAACCTTCCATCCTTAAACCACTGGCGCTCAGCA
GACTCCCTCCCGGAAGCCCAGCCAGGGTATGATGATTCCCGATGGACGGTCGCGAACAAGAATAGTACACTCAGT
CCACAAGCTCCTCTTACCCTGCCAGTCCTTTTTAGCTCTGACTATGGCTACTACGCCGGTGCTAAAATATACCGT
GGCTACTTTGACGGCACCAACCACACTGCAGTTAATATTACCGCCTCTGGCGGCCTCGCGTTTGGGTGGAACGCC
TGGCTAAACGGACATCTTATCGGGGGCCACACTGGCGATCCCAATCTATCAGCCACAAACATGACTCTGACGCTT
CCTGGGCCCCATCTCAGGACAATGAACAATGTCATCACAGTCATAGTTGACTACCATGGCCACGATGAAACTAAC
ATCGCCAACGGTGCTGGGAACCCTCGAGGCATCCTTGGCGCGTATCTTCTTCCAGGCGGTACACGCCCAGCAACC
GGTTTCAAACTGTGGAAGATCCAAGGCAATGCTGGTGGCGCGAAGAACATCGACCCAGTCCGCGGACCCATGAAT
GAGGGTGGCCTCTATGCCGAACGACTAGGATGGTTCCTCCCTGGCTTTCCGGCATCTGATAACAAGGAGTTCAAC
AGTACCTCCAGTCCACTGGACGGCATCTCGAAACCGGGTGTCCGTTTCTATGTCACCGCTTTCGACCTTGATATC
GACAGGGATCTAGATGCACCCATAGGGGTTTCTTTCTCAGCGCCAAACGGCACTATAGCACGTGTAATGCTTTGG
GTCAATGGGTATCAATACGGCAAATACGTCCCTCACATTGGTCCGCAGACGAAGTTTCCTGTTCCCCCGGGGATC
ATCAACAACCGGGGGCAAAATACATTAGCATTGAGTTTGTGGGCGCAAACCAATGATGGTGCGAAGCTCGATACT
GTCGAGCTGTTTACGTATGGACTGTATCAGACGGATTTTCAGTTTGATCGCGATTGGAGTTATTTGCAACCGGGG
TGGGAGGGTAGGAGCGTGTACGCGTAA
Transcript >Ani_SJS72_1|g8954.t1
ATGTGGCTGGATGTGCTGCAAAAGCTGAAGGCAAATGGCTTCAATACAATCAGTGTGTACTTCTTTTGGAGTTAT
CATTCGGCTTCCAAGGACGCATATGACTTTAAAACGGGAGCACATAACATACAGCGTCTCTTCGACATGGCCAAG
CAGGCGGGCCTATGGGTAATTGCGCGGCCGGGTCCTTATGTCAATGCACAGACAAATGCTGGTGGTTTAGCTCTA
TGGGGCTCTGATGGCTCCATGGGCAAATTGCGGACATCAGATGAGGCCTTTCATCAAGCGTGGCTTCCATATATG
AGGAAAGTCGGACAGATCATTGCAGCGAACCAGATCACAAGAGGTGGTCCCGTTATACTCTGCCAGGTAGAAAAC
GAACTCCAAGAGACCACTCATGAGCCAAACAATACTCTGGTTACGTATATGGAGCAGCTCGAGGCAGTCATTAGA
GATGCTGGGATAACCGTTCCTACGACTCATAACGAAAAAGGCATGAGATATGTATCCTGGTCAAGGGATTACGGA
AACGTTGGTGGCGCTGTCGACATTTATGGCTTGGACACCTACCCTGCAGGATTTCTTGTCGGGAACAGATGTGAT
GGAGCCACTGGATTCAATGTTGTTCGGACCTACTATCAGTGGTTCATGAACTATTCATGGACTGGTCCCATTTAT
CTCGCTGAGTTTGAGGGCGGGCGTACTTTGACCTGGGGTGCTCCACAGAATTATGATGATTGTCGAAGCGAGCAC
AGCACCACCTTTGTGGACATCTACTATAAGAACAACATCGGTCAGCGCGTGACGCTACAAAGCATATATGAAGGC
TATGGGGGGACTAATTGGGGCCATTCTGCTTCCCCAGTGGCATATACTAGCAATGACTATATGACCCCCCTCCGA
GAAACTCGCGAGCAATGGGCCAAGCTTTGGCAAACGAAGCTCATACAACTCTTCTCGGGATCTGCACCTGATTTA
CTCAAGACGTACATGTATGGGAACGGATCGGGTTACAGTCTTTCGACACTCGACGCTTATAGTTGGGTCCTGAAG
AACCCAGATACTCAGGCAACCTTCACTGTGCTGCAGCAGAACGAAACCCCATCAACCACTACCATTGCGTTTTCG
GCCTACTTGAACACCAGCCTTGGCAACATGACTGTTCCAGATATCCAGCTTCAAGGGCGACAGAGCAAGATTCTA
GTTACAGACTACATGTTTGGTAATCAAACACTTCTGTATTCATCAACAGATGTACTTACAAATGCCATCTTGCCC
GGACACGATGTTCTGGCTCTGTATCTATGGGAAGGTCAAACCGGCGAGTTCGCTCTCAAGACGCCAAGGAATTTG
ACGCTCCAGGTATATGGCGCGTCTATCGTGTCGTCCACACTTCATCCTGGCTACCAGAAGATTAAGTACACACAG
GCTACTGGCTCTACTGTCCTTCGTTTTACAAATGGGGTCATTGTCCTATTGCTCGATCAAACAACAGCATGGCAT
TTCTGGGCTCCGTCAACATCAAACTACCCTTCTCCTAGGCCAGACCAGAAGCTTTTCATTCTTGGTCCGTACCTC
GTCCGGTCTGCATCAGTCGAAAATGAAGTGCTTCAGGTCTCTGGAGACAATAACGGAACTACAACCCTGGAGAGC
TTCATCGGCGACGTGCCCATCAAAGCAATCGAGTGGAACGGCCAGCGACTCACAGCAACCAAGACGCCCTATGGC
TCCTACACAGCCCAAATCCCCGGTACAGAACACCGATCAGTAAACCTTCCATCCTTAAACCACTGGCGCTCAGCA
GACTCCCTCCCGGAAGCCCAGCCAGGGTATGATGATTCCCGATGGACGGTCGCGAACAAGAATAGTACACTCAGT
CCACAAGCTCCTCTTACCCTGCCAGTCCTTTTTAGCTCTGACTATGGCTACTACGCCGGTGCTAAAATATACCGT
GGCTACTTTGACGGCACCAACCACACTGCAGTTAATATTACCGCCTCTGGCGGCCTCGCGTTTGGGTGGAACGCC
TGGCTAAACGGACATCTTATCGGGGGCCACACTGGCGATCCCAATCTATCAGCCACAAACATGACTCTGACGCTT
CCTGGGCCCCATCTCAGGACAATGAACAATGTCATCACAGTCATAGTTGACTACCATGGCCACGATGAAACTAAC
ATCGCCAACGGTGCTGGGAACCCTCGAGGCATCCTTGGCGCGTATCTTCTTCCAGGCGGTACACGCCCAGCAACC
GGTTTCAAACTGTGGAAGATCCAAGGCAATGCTGGTGGCGCGAAGAACATCGACCCAGTCCGCGGACCCATGAAT
GAGGGTGGCCTCTATGCCGAACGACTAGGATGGTTCCTCCCTGGCTTTCCGGCATCTGATAACAAGGAGTTCAAC
AGTACCTCCAGTCCACTGGACGGCATCTCGAAACCGGGTGTCCGTTTCTATGTCACCGCTTTCGACCTTGATATC
GACAGGGATCTAGATGCACCCATAGGGGTTTCTTTCTCAGCGCCAAACGGCACTATAGCACGTGTAATGCTTTGG
GTCAATGGGTATCAATACGGCAAATACGTCCCTCACATTGGTCCGCAGACGAAGTTTCCTGTTCCCCCGGGGATC
ATCAACAACCGGGGGCAAAATACATTAGCATTGAGTTTGTGGGCGCAAACCAATGATGGTGCGAAGCTCGATACT
GTCGAGCTGTTTACGTATGGACTGTATCAGACGGATTTTCAGTTTGATCGCGATTGGAGTTATTTGCAACCGGGG
TGGGAGGGTAGGAGCGTGTACGCGTAA
Gene >Ani_SJS72_1|g8954.t1
ATGTGGCTGGTGAGTCAGCCTTATTTTTTTCGTACAGGGAGTTTTAGAGACTGAGGCTTGGTCAATATAGGATGT
GCTGCAAAAGCTGAAGGCAAATGGCTTCAATACAATCAGGTGGGTAAGTTGCCTTCTACAAATCGGACAACCATT
TAAACCTTAACTTCAGTGTGTACTTCTTTTGGAGTTATCATTCGGCTTCCAAGGACGCATATGACTTTAAAACGG
GAGCACATAACATACAGCGTCTCTTCGACATGGCCAAGCAGGCGGGCCTATGGGTAATTGCGCGGCCGGGTCCTT
ATGTCAATGTAAGCGGCCATACTCGCTCATATCCCTGAGTTCGTGGAACAGAATGACTAAATAACCCCAAAATAG
GCACAGACAAATGCTGGTGGTTTAGCTCTATGGGGCTCTGATGGCTCCATGGGCAAATTGCGGACATCAGATGAG
GCCTTTCATCAAGCGTGGCTTCCATATATGAGGAAAGTCGGACAGATCATTGCAGCGAACCAGATCACAAGAGGT
GGTGTATGTAAACAGCTTCCTCCGGTGGTTAGAGTGAGATTTGCTAACCTCAAGCGTGTAGCCCGTTATACTCTG
CCAGGTAGAAAACGAACTCCAAGAGACCACTCATGAGCCAAACAATACTCTGGTTACGTATATGGAGCAGCTCGA
GGCAGTCATTAGAGATGCTGGGATAACCGTTCCTACGACTCATAACGAAAAAGGCATGAGATATGTATCCTGGTC
AAGGGATTACGGAAACGTTGGTGGCGCTGTCGACATTTATGGCTTGGACACCTACCCTGCAGGATTTCTTGTCGG
GAACAGATGTGATGGAGCCACTGGATTCAATGTTGTTCGGACCTACTATCAGTGGTTCATGAACTATTCATGGAC
TGGTCCCATTTATCTCGCTGAGTTTGAGGGCGGGCGTACTTTGACCTGGGGTGCTCCACAGAATTATGATGATGT
GAGTGGCTACTCAGTCAATCAGCAAGAATATGTTATAGCTATACATTGTCCATCGCCAAGGCTAATGATTATATA
GTGTCGAAGCGAGCACAGCACCACCTTTGTGGACATCTACTATAAGAACAACATCGGTCAGCGCGTGACGCTACA
AAGCATATATGAAGGCTATGGGGGGACTAATTGGGGCCATTGTGAGTAGATCTGCCTGTCGCGAACAACATTGCA
GACTATTTGACCACCCTACAGCTGCTTCCCCAGTGGCATATACTAGCAATGACTATATGTAATACTTCATTCTTT
TGAATCTCTGAATATGTGACTCACCAGATGAACAGGACCCCCCTCCGAGAAACTCGCGAGCAATGGGCCAAGCTT
TGGCAAACGAAGCTCATACAACTCTTCTCGGGATCTGCACCTGATTTACTCAAGACGTACATGTATGGGAACGGA
TCGGGTTACAGTGTCAGACATCCATCCGGGTCATGATATGCAGCCCTGCTAACAAGCTAGTAGCTTTCGACACTC
GACGCTTATAGTTGGGTCCTGAAGAACCCAGATACTCAGGCAACCTTCACTGTGCTGCAGCAGAACGAAACCCCA
TCAACCACTACCATTGCGTTTTCGGCCTACTTGAACACCAGCCTTGGCAACATGACTGTTCCAGATATCCAGCTT
CAAGGGCGACAGAGCAAGATTCTAGTTACAGACTACATGTTTGGTAATCAAACACTTCTGTATTCATCAACAGAT
GTACTTACAAATGCCATCTTGCCCGGACACGATGTTCTGGCTCTGTATCTATGGGAAGGTCAAACCGGCGAGTTC
GCTCTCAAGACGCCAAGGAATTTGACGCTCCAGGTATATGGCGCGTCTATCGTGTCGTCCACACTTCATCCTGGC
TACCAGAAGATTAAGTACACACAGGCTACTGGCTCTACTGTCCTTCGTTTTACAAATGGGGTCATTGTCCTATTG
CTCGATCAAACAACAGCATGGCATTTCTGGGCTCCGTCAACATCAAACTACCCTTCTCCTAGGCCAGACCAGAAG
CTTTTCATTCTTGGTCCGTACCTCGTCCGGTCTGCATCAGTCGAAAATGAAGTGCTTCAGGTCTCTGGAGACAAT
AACGGAACTACAACCCTGGAGAGCTTCATCGGCGACGTGCCCATCAAAGCAATCGAGTGGAACGGCCAGCGACTC
ACAGCAACCAAGACGCCCTATGGCTCCTACACAGCCCAAATCCCCGGTACAGAACACCGATCAGTAAACCTTCCA
TCCTTAAACCACTGGCGCTCAGCAGACTCCCTCCCGGAAGCCCAGCCAGGGTATGATGATTCCCGATGGACGGTC
GCGAACAAGAATAGTACACTCAGTCCACAAGCTCCTCTTACCCTGCCAGTCCTTTTTAGCTCTGACTATGGCTAC
TACGCCGGTGCTAAAATATACCGTGGCTACTTTGACGGCACCAACCACACTGCAGTTAATATTACCGCCTCTGGC
GGCCTCGCGTTTGGGTGGAACGCCTGGCTAAACGGACATCTTATCGGGGGCCACACTGGCGATCCCAATCTATCA
GCCACAAACATGACTCTGACGCTTCCTGGGCCCCATCTCAGGACAATGAACAATGTCATCACAGTCATAGTTGAC
TACCATGGCCACGATGAAACTAACATCGCCAACGGTGCTGGGAACCCTCGAGGCATCCTTGGCGCGTATCTTCTT
CCAGGCGGTACACGCCCAGCAACCGGTTTCAAACTGTGGAAGATCCAAGGCAATGCTGGTGGCGCGAAGAACATC
GACCCAGTCCGCGGACCCATGAATGAGGGTGGCCTCTATGCCGAACGACTAGGATGGTTCCTCCCTGGCTTTCCG
GCATCTGATAACAAGGAGTTCAACAGTACCTCCAGTCCACTGGACGGCATCTCGAAACCGGGTGTCCGTTTCTAT
GTCACCGCTTTCGACCTTGATATCGACAGGGATCTAGATGCACCCATAGGGGTTTCTTTCTCAGCGCCAAACGGC
ACTATAGCACGTGTAATGCTTTGGGTCAATGGGGTAAGTCTTAGGTCCATTGTACAACATGTAATATACAGCATA
TATACTGACGTTCATCTGCCATGTTAAAGTATCAATACGGCAAATACGTCCCTCACATTGGTCCGCAGACGAAGT
TTCCTGTTCCCCCGGGGATCATCAACAACCGGGGGCAAAATACATTAGCATTGAGTTTGTGGGCGCAAACCAATG
ATGGTGCGAAGCTCGATACTGTCGAGCTGTTTACGTATGGACTGTATCAGACGGATTTTCAGTTTGATCGCGATT
GGAGTTATTTGCAACCGGGGTGGGAGGGTAGGAGCGTGTACGCGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail