Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g8921.t1
Gene name
Locationscaffold_088:128220..130860
Strand+
Gene length (bp)2640
Transcript length (bp)2640
Coding sequence length (bp)2640
Protein length (aa) 880

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.5

Transmembrane Domains

Domain # Start End Length
1 25 47 22
2 52 74 22
3 107 124 17
4 207 229 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g8921.t1
MMLSPSEQVVVYGRTLNPEYESLDMLDYTAGLDTVFAALILFFFVAVNWQTIASTISFGAKLLAAIFSPLEFFVS
RFDAFKRWMATSQMERRVSDLCKWYFPSRRPIAMAFWVFATLVTINWTCQDLLAPSYHFLYGVVGGMGPAGWDHW
EYCLNLDRGSPAGRWSNSRRLQGFHCVGVDIGVELFSVLEDHIPTFSVGDDIEHLRIFRFVGFFFTLASIIALAV
IGITQSSLFKAIKMLCWTRIESKNGPEDEVQPQDTALPEQVELLSAKIGTYEAMLEEVRGQLAAKTEQVNRMEER
SDELQSTNQMLAARDEKAKVAQQEDLIIKLRQELDRVNCLPIMANGRARAHYKSDSREQTLANRVAELEKQLAMK
TEADANSRGIIESLQAELQVRTEEANAIASRLVTVEAQKLRTAEEEVLRKDTEIRELQERLQVQEDQSYERAMEL
SAAEDQLTSQDVLIHDLQERIRAQEAAPQAQATEELHTAEKVLQMKVAEIQDLEGQLQFYQAQCQMQAAHLGEAE
EQVNGLRAQLGEYHYVVEQLRLKEEELRVLKGQFEKLEGEGREKQEELDYVSVQYDSLFEDHVDLQTRLEGDEAA
QENLGLRAEVQSLRSALDGNNAAQEALDLRVEVNAVKAFAEEKVREAEERMMEAEAVANALRQADRGLRETMQGL
KKAYDDEVERYDDEVEKERAAANEARKQVKGLAEELKEMSQQVGIALRDAQRFQEQKEGTEAEMDKLEGVNDVLE
HRLKYWERSESSQEIPKRRTGDLGSLATALDSSRVEISRQQTEINRLHALLRQAQTESAASAPSVPSDQALRDSV
NRLRQALEAEKRQRTEEQVRWGRRVRELEEETQRLRVSSSNAGLGRGRGRGGGG*
Coding >Ani_SJS72_1|g8921.t1
ATGATGTTGTCTCCCTCGGAACAGGTGGTGGTGTACGGAAGGACCCTGAACCCGGAGTACGAGTCCTTGGACATG
CTTGACTACACTGCAGGACTGGACACCGTCTTTGCAGCTCTTATTCTCTTCTTTTTCGTTGCCGTAAACTGGCAG
ACCATCGCATCTACCATCTCGTTCGGAGCCAAGCTGCTTGCAGCCATTTTTTCTCCTCTCGAGTTCTTCGTGTCG
CGCTTCGACGCGTTCAAGAGATGGATGGCCACTAGCCAGATGGAGCGTCGCGTTTCTGACCTCTGTAAATGGTAC
TTTCCTTCCCGTCGTCCCATTGCCATGGCCTTCTGGGTTTTTGCCACACTGGTCACGATCAATTGGACCTGTCAA
GATCTTTTGGCTCCCAGCTACCATTTCTTGTATGGCGTCGTCGGTGGCATGGGACCCGCAGGCTGGGATCACTGG
GAATACTGTCTTAACCTTGATCGTGGTTCTCCCGCAGGACGGTGGTCCAACAGTCGGCGGCTCCAGGGATTCCAT
TGTGTCGGGGTAGACATCGGCGTGGAGTTGTTTTCTGTCTTGGAAGACCACATCCCAACGTTCAGCGTTGGAGAT
GATATCGAACATCTCCGTATCTTTCGCTTCGTCGGCTTCTTTTTCACTCTCGCCAGCATTATTGCTTTGGCTGTC
ATCGGCATCACTCAATCTTCTCTTTTCAAGGCTATTAAAATGCTTTGCTGGACACGTATCGAATCAAAGAACGGT
CCTGAAGATGAGGTACAGCCCCAAGATACAGCGTTGCCCGAGCAAGTCGAACTTCTTTCGGCCAAGATTGGCACC
TATGAAGCAATGCTGGAAGAGGTACGGGGCCAGCTGGCCGCAAAGACCGAGCAGGTGAACCGAATGGAGGAGCGT
TCTGACGAACTCCAGTCGACAAATCAGATGCTGGCTGCCCGTGACGAGAAAGCCAAGGTTGCCCAGCAAGAAGAT
CTGATAATTAAGCTTCGCCAAGAGCTAGACCGGGTTAATTGTCTACCTATCATGGCTAACGGAAGAGCGCGGGCG
CATTACAAGTCTGACTCACGGGAGCAGACTCTCGCCAATCGTGTCGCCGAGTTGGAGAAGCAACTAGCTATGAAG
ACTGAAGCGGATGCCAACTCTCGAGGCATCATTGAGTCGCTTCAAGCAGAGCTCCAGGTTCGGACCGAAGAGGCC
AACGCCATCGCGAGCCGTCTCGTTACCGTCGAAGCTCAGAAACTCCGTACTGCAGAGGAGGAAGTTCTCCGCAAG
GATACAGAGATCCGTGAACTCCAGGAACGACTTCAAGTTCAGGAGGATCAGTCCTACGAGCGGGCGATGGAACTT
AGCGCCGCCGAAGACCAGCTTACTAGCCAAGACGTTCTGATCCATGACTTGCAGGAACGAATCCGGGCTCAAGAG
GCAGCACCCCAGGCGCAGGCCACGGAGGAACTTCACACCGCCGAAAAAGTGCTGCAGATGAAGGTCGCGGAAATT
CAAGACCTGGAAGGACAACTTCAGTTCTACCAGGCACAGTGCCAGATGCAAGCAGCACATCTCGGTGAAGCAGAA
GAACAAGTCAATGGCCTGCGGGCCCAGCTCGGAGAATACCACTACGTAGTGGAACAACTGCGTCTCAAGGAAGAG
GAGCTCCGCGTCTTGAAGGGACAGTTCGAAAAGCTGGAGGGAGAGGGTCGTGAAAAGCAGGAAGAACTCGATTAT
GTCTCTGTCCAGTACGACTCGTTGTTCGAGGATCATGTGGATCTTCAGACAAGGTTGGAGGGGGATGAGGCTGCC
CAGGAGAATCTGGGTCTGCGGGCCGAGGTCCAGTCTCTTAGGTCTGCGTTGGATGGGAATAACGCTGCCCAGGAA
GCCTTGGATTTGCGGGTCGAGGTCAACGCGGTGAAGGCGTTCGCTGAAGAGAAGGTAAGGGAAGCCGAGGAGAGG
ATGATGGAGGCCGAGGCGGTCGCAAATGCCCTCCGGCAAGCCGACAGAGGGCTGCGCGAGACAATGCAAGGCCTC
AAGAAGGCCTACGATGACGAGGTGGAGAGATACGATGACGAGGTCGAGAAGGAACGTGCGGCTGCCAACGAGGCT
CGGAAGCAGGTGAAGGGTCTGGCGGAGGAGCTCAAGGAGATGTCGCAGCAAGTCGGCATCGCCTTGAGGGATGCT
CAGCGCTTCCAGGAGCAGAAGGAGGGCACCGAGGCGGAGATGGACAAGCTCGAGGGCGTCAATGACGTCCTTGAG
CACCGTCTGAAGTATTGGGAGAGGAGTGAGAGTTCGCAAGAGATTCCCAAGCGCCGTACGGGCGACTTGGGGTCT
CTTGCGACGGCCCTGGACTCGTCCAGGGTCGAAATCTCCAGGCAGCAGACGGAGATAAACCGTCTGCATGCCCTC
CTCCGTCAAGCTCAGACGGAGTCCGCCGCCTCAGCCCCCTCTGTTCCCTCCGACCAGGCCCTTCGAGACAGCGTC
AACCGCCTGCGCCAGGCCTTGGAGGCCGAGAAAAGACAGCGAACCGAGGAGCAGGTTCGCTGGGGCCGGCGGGTG
CGTGAGTTGGAGGAGGAAACCCAGAGGCTGCGGGTTTCCTCCTCCAACGCCGGCCTCGGTCGCGGTCGTGGCCGT
GGCGGAGGCGGTTGA
Transcript >Ani_SJS72_1|g8921.t1
ATGATGTTGTCTCCCTCGGAACAGGTGGTGGTGTACGGAAGGACCCTGAACCCGGAGTACGAGTCCTTGGACATG
CTTGACTACACTGCAGGACTGGACACCGTCTTTGCAGCTCTTATTCTCTTCTTTTTCGTTGCCGTAAACTGGCAG
ACCATCGCATCTACCATCTCGTTCGGAGCCAAGCTGCTTGCAGCCATTTTTTCTCCTCTCGAGTTCTTCGTGTCG
CGCTTCGACGCGTTCAAGAGATGGATGGCCACTAGCCAGATGGAGCGTCGCGTTTCTGACCTCTGTAAATGGTAC
TTTCCTTCCCGTCGTCCCATTGCCATGGCCTTCTGGGTTTTTGCCACACTGGTCACGATCAATTGGACCTGTCAA
GATCTTTTGGCTCCCAGCTACCATTTCTTGTATGGCGTCGTCGGTGGCATGGGACCCGCAGGCTGGGATCACTGG
GAATACTGTCTTAACCTTGATCGTGGTTCTCCCGCAGGACGGTGGTCCAACAGTCGGCGGCTCCAGGGATTCCAT
TGTGTCGGGGTAGACATCGGCGTGGAGTTGTTTTCTGTCTTGGAAGACCACATCCCAACGTTCAGCGTTGGAGAT
GATATCGAACATCTCCGTATCTTTCGCTTCGTCGGCTTCTTTTTCACTCTCGCCAGCATTATTGCTTTGGCTGTC
ATCGGCATCACTCAATCTTCTCTTTTCAAGGCTATTAAAATGCTTTGCTGGACACGTATCGAATCAAAGAACGGT
CCTGAAGATGAGGTACAGCCCCAAGATACAGCGTTGCCCGAGCAAGTCGAACTTCTTTCGGCCAAGATTGGCACC
TATGAAGCAATGCTGGAAGAGGTACGGGGCCAGCTGGCCGCAAAGACCGAGCAGGTGAACCGAATGGAGGAGCGT
TCTGACGAACTCCAGTCGACAAATCAGATGCTGGCTGCCCGTGACGAGAAAGCCAAGGTTGCCCAGCAAGAAGAT
CTGATAATTAAGCTTCGCCAAGAGCTAGACCGGGTTAATTGTCTACCTATCATGGCTAACGGAAGAGCGCGGGCG
CATTACAAGTCTGACTCACGGGAGCAGACTCTCGCCAATCGTGTCGCCGAGTTGGAGAAGCAACTAGCTATGAAG
ACTGAAGCGGATGCCAACTCTCGAGGCATCATTGAGTCGCTTCAAGCAGAGCTCCAGGTTCGGACCGAAGAGGCC
AACGCCATCGCGAGCCGTCTCGTTACCGTCGAAGCTCAGAAACTCCGTACTGCAGAGGAGGAAGTTCTCCGCAAG
GATACAGAGATCCGTGAACTCCAGGAACGACTTCAAGTTCAGGAGGATCAGTCCTACGAGCGGGCGATGGAACTT
AGCGCCGCCGAAGACCAGCTTACTAGCCAAGACGTTCTGATCCATGACTTGCAGGAACGAATCCGGGCTCAAGAG
GCAGCACCCCAGGCGCAGGCCACGGAGGAACTTCACACCGCCGAAAAAGTGCTGCAGATGAAGGTCGCGGAAATT
CAAGACCTGGAAGGACAACTTCAGTTCTACCAGGCACAGTGCCAGATGCAAGCAGCACATCTCGGTGAAGCAGAA
GAACAAGTCAATGGCCTGCGGGCCCAGCTCGGAGAATACCACTACGTAGTGGAACAACTGCGTCTCAAGGAAGAG
GAGCTCCGCGTCTTGAAGGGACAGTTCGAAAAGCTGGAGGGAGAGGGTCGTGAAAAGCAGGAAGAACTCGATTAT
GTCTCTGTCCAGTACGACTCGTTGTTCGAGGATCATGTGGATCTTCAGACAAGGTTGGAGGGGGATGAGGCTGCC
CAGGAGAATCTGGGTCTGCGGGCCGAGGTCCAGTCTCTTAGGTCTGCGTTGGATGGGAATAACGCTGCCCAGGAA
GCCTTGGATTTGCGGGTCGAGGTCAACGCGGTGAAGGCGTTCGCTGAAGAGAAGGTAAGGGAAGCCGAGGAGAGG
ATGATGGAGGCCGAGGCGGTCGCAAATGCCCTCCGGCAAGCCGACAGAGGGCTGCGCGAGACAATGCAAGGCCTC
AAGAAGGCCTACGATGACGAGGTGGAGAGATACGATGACGAGGTCGAGAAGGAACGTGCGGCTGCCAACGAGGCT
CGGAAGCAGGTGAAGGGTCTGGCGGAGGAGCTCAAGGAGATGTCGCAGCAAGTCGGCATCGCCTTGAGGGATGCT
CAGCGCTTCCAGGAGCAGAAGGAGGGCACCGAGGCGGAGATGGACAAGCTCGAGGGCGTCAATGACGTCCTTGAG
CACCGTCTGAAGTATTGGGAGAGGAGTGAGAGTTCGCAAGAGATTCCCAAGCGCCGTACGGGCGACTTGGGGTCT
CTTGCGACGGCCCTGGACTCGTCCAGGGTCGAAATCTCCAGGCAGCAGACGGAGATAAACCGTCTGCATGCCCTC
CTCCGTCAAGCTCAGACGGAGTCCGCCGCCTCAGCCCCCTCTGTTCCCTCCGACCAGGCCCTTCGAGACAGCGTC
AACCGCCTGCGCCAGGCCTTGGAGGCCGAGAAAAGACAGCGAACCGAGGAGCAGGTTCGCTGGGGCCGGCGGGTG
CGTGAGTTGGAGGAGGAAACCCAGAGGCTGCGGGTTTCCTCCTCCAACGCCGGCCTCGGTCGCGGTCGTGGCCGT
GGCGGAGGCGGTTGA
Gene >Ani_SJS72_1|g8921.t1
ATGATGTTGTCTCCCTCGGAACAGGTGGTGGTGTACGGAAGGACCCTGAACCCGGAGTACGAGTCCTTGGACATG
CTTGACTACACTGCAGGACTGGACACCGTCTTTGCAGCTCTTATTCTCTTCTTTTTCGTTGCCGTAAACTGGCAG
ACCATCGCATCTACCATCTCGTTCGGAGCCAAGCTGCTTGCAGCCATTTTTTCTCCTCTCGAGTTCTTCGTGTCG
CGCTTCGACGCGTTCAAGAGATGGATGGCCACTAGCCAGATGGAGCGTCGCGTTTCTGACCTCTGTAAATGGTAC
TTTCCTTCCCGTCGTCCCATTGCCATGGCCTTCTGGGTTTTTGCCACACTGGTCACGATCAATTGGACCTGTCAA
GATCTTTTGGCTCCCAGCTACCATTTCTTGTATGGCGTCGTCGGTGGCATGGGACCCGCAGGCTGGGATCACTGG
GAATACTGTCTTAACCTTGATCGTGGTTCTCCCGCAGGACGGTGGTCCAACAGTCGGCGGCTCCAGGGATTCCAT
TGTGTCGGGGTAGACATCGGCGTGGAGTTGTTTTCTGTCTTGGAAGACCACATCCCAACGTTCAGCGTTGGAGAT
GATATCGAACATCTCCGTATCTTTCGCTTCGTCGGCTTCTTTTTCACTCTCGCCAGCATTATTGCTTTGGCTGTC
ATCGGCATCACTCAATCTTCTCTTTTCAAGGCTATTAAAATGCTTTGCTGGACACGTATCGAATCAAAGAACGGT
CCTGAAGATGAGGTACAGCCCCAAGATACAGCGTTGCCCGAGCAAGTCGAACTTCTTTCGGCCAAGATTGGCACC
TATGAAGCAATGCTGGAAGAGGTACGGGGCCAGCTGGCCGCAAAGACCGAGCAGGTGAACCGAATGGAGGAGCGT
TCTGACGAACTCCAGTCGACAAATCAGATGCTGGCTGCCCGTGACGAGAAAGCCAAGGTTGCCCAGCAAGAAGAT
CTGATAATTAAGCTTCGCCAAGAGCTAGACCGGGTTAATTGTCTACCTATCATGGCTAACGGAAGAGCGCGGGCG
CATTACAAGTCTGACTCACGGGAGCAGACTCTCGCCAATCGTGTCGCCGAGTTGGAGAAGCAACTAGCTATGAAG
ACTGAAGCGGATGCCAACTCTCGAGGCATCATTGAGTCGCTTCAAGCAGAGCTCCAGGTTCGGACCGAAGAGGCC
AACGCCATCGCGAGCCGTCTCGTTACCGTCGAAGCTCAGAAACTCCGTACTGCAGAGGAGGAAGTTCTCCGCAAG
GATACAGAGATCCGTGAACTCCAGGAACGACTTCAAGTTCAGGAGGATCAGTCCTACGAGCGGGCGATGGAACTT
AGCGCCGCCGAAGACCAGCTTACTAGCCAAGACGTTCTGATCCATGACTTGCAGGAACGAATCCGGGCTCAAGAG
GCAGCACCCCAGGCGCAGGCCACGGAGGAACTTCACACCGCCGAAAAAGTGCTGCAGATGAAGGTCGCGGAAATT
CAAGACCTGGAAGGACAACTTCAGTTCTACCAGGCACAGTGCCAGATGCAAGCAGCACATCTCGGTGAAGCAGAA
GAACAAGTCAATGGCCTGCGGGCCCAGCTCGGAGAATACCACTACGTAGTGGAACAACTGCGTCTCAAGGAAGAG
GAGCTCCGCGTCTTGAAGGGACAGTTCGAAAAGCTGGAGGGAGAGGGTCGTGAAAAGCAGGAAGAACTCGATTAT
GTCTCTGTCCAGTACGACTCGTTGTTCGAGGATCATGTGGATCTTCAGACAAGGTTGGAGGGGGATGAGGCTGCC
CAGGAGAATCTGGGTCTGCGGGCCGAGGTCCAGTCTCTTAGGTCTGCGTTGGATGGGAATAACGCTGCCCAGGAA
GCCTTGGATTTGCGGGTCGAGGTCAACGCGGTGAAGGCGTTCGCTGAAGAGAAGGTAAGGGAAGCCGAGGAGAGG
ATGATGGAGGCCGAGGCGGTCGCAAATGCCCTCCGGCAAGCCGACAGAGGGCTGCGCGAGACAATGCAAGGCCTC
AAGAAGGCCTACGATGACGAGGTGGAGAGATACGATGACGAGGTCGAGAAGGAACGTGCGGCTGCCAACGAGGCT
CGGAAGCAGGTGAAGGGTCTGGCGGAGGAGCTCAAGGAGATGTCGCAGCAAGTCGGCATCGCCTTGAGGGATGCT
CAGCGCTTCCAGGAGCAGAAGGAGGGCACCGAGGCGGAGATGGACAAGCTCGAGGGCGTCAATGACGTCCTTGAG
CACCGTCTGAAGTATTGGGAGAGGAGTGAGAGTTCGCAAGAGATTCCCAAGCGCCGTACGGGCGACTTGGGGTCT
CTTGCGACGGCCCTGGACTCGTCCAGGGTCGAAATCTCCAGGCAGCAGACGGAGATAAACCGTCTGCATGCCCTC
CTCCGTCAAGCTCAGACGGAGTCCGCCGCCTCAGCCCCCTCTGTTCCCTCCGACCAGGCCCTTCGAGACAGCGTC
AACCGCCTGCGCCAGGCCTTGGAGGCCGAGAAAAGACAGCGAACCGAGGAGCAGGTTCGCTGGGGCCGGCGGGTG
CGTGAGTTGGAGGAGGAAACCCAGAGGCTGCGGGTTTCCTCCTCCAACGCCGGCCTCGGTCGCGGTCGTGGCCGT
GGCGGAGGCGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail