Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g8842.t1
Gene name
Locationscaffold_087:15460..17590
Strand-
Gene length (bp)2130
Transcript length (bp)2031
Coding sequence length (bp)2031
Protein length (aa) 677

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17390 Bac_rhamnosid_C Bacterial alpha-L-rhamnosidase C-terminal domain 4.1E-07 582 634

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g8842.t1
MRWHKLLPGVLALLPLSVAQSCWRNTTCSGPTESAFSGPWEKNIFAPSSRTVNPEKLFLITQPDKTEEYSPFALH
GNGSLVVYDFGKEVGGIVSVNFSSTGSGALGVAFTEAKNWIGEWSDSSNGGFKGPDGALYGNFTEAGSHYYVMPD
KSLRGGFRYLTLFLITSDNSTIQIEDVNLEIGFQPTWSNLKAYQGYFHSNDDLLNKIWYTGAYTLQTNEVPTDTG
RQIPAMAVGWANNCTLGPGDTIIVDGAKRDRAVWPGDMGIAVPSAFVSLGDLDSVKNALQVMYDTQNNSTGAFDE
SGPPLSQKDSDTYHMWTMVGTYNYMLFTNDSDFLERNWEGYQKAMDYIYGKVTYPSGLLNVTGTRDWARWQQGYN
NSEAQMILYHTLNTGAELATWAGDSGDLSSTWTSRAEKLRQAINEYCWDDSYGAFKDNATDTTLHPQDANSMALL
FGVVDADRAASISERLTDNWTPIGAVAPELPENISPFISSFEIQGHLTVGQPQRALELIRRSWGWYYNNANGTQS
TVIEGYLQNGTFGYRSDRGYYYDTAYVSHSHGWSSGPTSALTNYIVGISVTSPLGATWRIAPQFVDLQSAEGGFT
TSLGKFQAGWSKTDKGYTLDFTVPHGTQGNLTLPFVSAAKPSIKIDGTEISRGVQYANSTATVTVSGGGTYKVEV
Q*
Coding >Ani_SJS72_1|g8842.t1
ATGCGCTGGCACAAGCTCTTGCCGGGCGTGCTCGCTCTGCTCCCTCTCTCAGTTGCTCAAAGCTGTTGGCGCAAC
ACCACTTGTTCTGGTCCGACCGAAAGCGCTTTCTCCGGGCCATGGGAGAAAAACATTTTCGCGCCGTCCTCGAGA
ACCGTTAACCCTGAGAAGCTTTTTCTCATTACGCAGCCGGATAAGACGGAAGAGTATTCCCCATTTGCGCTTCAT
GGAAACGGTTCATTGGTGGTCTATGACTTCGGAAAAGAAGTTGGCGGCATTGTCTCCGTAAATTTCAGCTCCACA
GGCAGTGGTGCACTAGGAGTGGCATTTACCGAAGCGAAGAACTGGATTGGCGAGTGGTCGGATTCGTCGAATGGA
GGCTTCAAAGGCCCTGATGGTGCGCTCTACGGCAACTTCACCGAGGCCGGAAGTCACTACTATGTGATGCCGGAT
AAGAGCTTGCGTGGTGGATTTCGTTATCTGACTCTTTTCTTGATCACCAGCGACAACTCCACCATCCAAATCGAG
GATGTGAACTTGGAGATCGGCTTTCAGCCTACCTGGTCCAATTTGAAGGCCTACCAGGGGTACTTCCATTCCAAT
GACGATTTGCTCAACAAGATCTGGTACACTGGTGCCTACACTCTGCAGACGAACGAGGTGCCGACCGACACGGGA
CGGCAGATCCCAGCGATGGCCGTAGGCTGGGCGAATAATTGCACCCTTGGACCTGGCGATACGATCATTGTCGAC
GGAGCGAAGCGTGACCGTGCAGTGTGGCCGGGTGACATGGGGATTGCTGTCCCTTCCGCGTTTGTGAGTTTGGGC
GACTTGGACAGTGTCAAGAATGCGCTGCAGGTTATGTATGACACGCAGAACAACTCGACAGGTGCATTCGACGAG
TCTGGCCCACCGCTGAGCCAGAAAGACTCGGATACATACCACATGTGGACAATGGTGGGGACCTACAACTACATG
CTTTTTACCAATGACAGCGACTTCCTCGAGCGAAACTGGGAGGGATATCAGAAGGCCATGGACTACATCTACGGT
AAGGTGACTTATCCCAGCGGCTTGCTGAATGTCACGGGTACTCGCGACTGGGCCAGATGGCAGCAAGGATACAAC
AACTCCGAGGCGCAGATGATTTTGTATCACACCCTCAACACAGGCGCGGAGCTCGCCACCTGGGCTGGAGATTCA
GGCGACCTGTCCAGCACCTGGACCAGCCGGGCGGAGAAGCTGCGTCAAGCCATTAACGAATACTGCTGGGATGAC
TCGTACGGCGCATTCAAAGACAACGCCACCGACACCACCCTGCACCCTCAAGACGCGAACAGCATGGCCCTGCTC
TTCGGGGTCGTGGATGCGGACCGGGCCGCCAGCATTTCTGAAAGACTAACGGACAACTGGACCCCAATTGGAGCC
GTGGCACCCGAACTGCCAGAGAATATCTCGCCGTTCATCTCATCGTTCGAGATCCAGGGCCATCTGACCGTGGGG
CAGCCACAACGAGCACTGGAGCTAATCCGCCGCAGCTGGGGATGGTACTACAACAATGCGAACGGCACACAGAGC
ACAGTCATCGAAGGCTATCTACAGAACGGCACGTTCGGCTACCGCTCTGACCGCGGGTACTACTATGACACGGCA
TATGTGTCACACTCGCACGGTTGGTCTTCAGGACCGACGTCGGCGCTGACGAACTACATCGTGGGGATCAGTGTC
ACATCTCCACTGGGGGCGACCTGGCGCATTGCCCCGCAGTTTGTCGATCTGCAGTCCGCCGAAGGTGGATTCACG
ACGTCGCTTGGAAAGTTTCAGGCTGGATGGTCAAAGACAGACAAGGGGTACACGCTCGACTTTACAGTTCCGCAC
GGGACACAGGGGAACCTCACGCTGCCGTTCGTCAGTGCCGCGAAGCCATCTATCAAGATCGACGGGACGGAGATC
AGCCGGGGAGTGCAGTATGCCAACTCGACGGCGACCGTGACGGTCAGCGGAGGAGGAACGTACAAGGTGGAGGTG
CAGTAG
Transcript >Ani_SJS72_1|g8842.t1
ATGCGCTGGCACAAGCTCTTGCCGGGCGTGCTCGCTCTGCTCCCTCTCTCAGTTGCTCAAAGCTGTTGGCGCAAC
ACCACTTGTTCTGGTCCGACCGAAAGCGCTTTCTCCGGGCCATGGGAGAAAAACATTTTCGCGCCGTCCTCGAGA
ACCGTTAACCCTGAGAAGCTTTTTCTCATTACGCAGCCGGATAAGACGGAAGAGTATTCCCCATTTGCGCTTCAT
GGAAACGGTTCATTGGTGGTCTATGACTTCGGAAAAGAAGTTGGCGGCATTGTCTCCGTAAATTTCAGCTCCACA
GGCAGTGGTGCACTAGGAGTGGCATTTACCGAAGCGAAGAACTGGATTGGCGAGTGGTCGGATTCGTCGAATGGA
GGCTTCAAAGGCCCTGATGGTGCGCTCTACGGCAACTTCACCGAGGCCGGAAGTCACTACTATGTGATGCCGGAT
AAGAGCTTGCGTGGTGGATTTCGTTATCTGACTCTTTTCTTGATCACCAGCGACAACTCCACCATCCAAATCGAG
GATGTGAACTTGGAGATCGGCTTTCAGCCTACCTGGTCCAATTTGAAGGCCTACCAGGGGTACTTCCATTCCAAT
GACGATTTGCTCAACAAGATCTGGTACACTGGTGCCTACACTCTGCAGACGAACGAGGTGCCGACCGACACGGGA
CGGCAGATCCCAGCGATGGCCGTAGGCTGGGCGAATAATTGCACCCTTGGACCTGGCGATACGATCATTGTCGAC
GGAGCGAAGCGTGACCGTGCAGTGTGGCCGGGTGACATGGGGATTGCTGTCCCTTCCGCGTTTGTGAGTTTGGGC
GACTTGGACAGTGTCAAGAATGCGCTGCAGGTTATGTATGACACGCAGAACAACTCGACAGGTGCATTCGACGAG
TCTGGCCCACCGCTGAGCCAGAAAGACTCGGATACATACCACATGTGGACAATGGTGGGGACCTACAACTACATG
CTTTTTACCAATGACAGCGACTTCCTCGAGCGAAACTGGGAGGGATATCAGAAGGCCATGGACTACATCTACGGT
AAGGTGACTTATCCCAGCGGCTTGCTGAATGTCACGGGTACTCGCGACTGGGCCAGATGGCAGCAAGGATACAAC
AACTCCGAGGCGCAGATGATTTTGTATCACACCCTCAACACAGGCGCGGAGCTCGCCACCTGGGCTGGAGATTCA
GGCGACCTGTCCAGCACCTGGACCAGCCGGGCGGAGAAGCTGCGTCAAGCCATTAACGAATACTGCTGGGATGAC
TCGTACGGCGCATTCAAAGACAACGCCACCGACACCACCCTGCACCCTCAAGACGCGAACAGCATGGCCCTGCTC
TTCGGGGTCGTGGATGCGGACCGGGCCGCCAGCATTTCTGAAAGACTAACGGACAACTGGACCCCAATTGGAGCC
GTGGCACCCGAACTGCCAGAGAATATCTCGCCGTTCATCTCATCGTTCGAGATCCAGGGCCATCTGACCGTGGGG
CAGCCACAACGAGCACTGGAGCTAATCCGCCGCAGCTGGGGATGGTACTACAACAATGCGAACGGCACACAGAGC
ACAGTCATCGAAGGCTATCTACAGAACGGCACGTTCGGCTACCGCTCTGACCGCGGGTACTACTATGACACGGCA
TATGTGTCACACTCGCACGGTTGGTCTTCAGGACCGACGTCGGCGCTGACGAACTACATCGTGGGGATCAGTGTC
ACATCTCCACTGGGGGCGACCTGGCGCATTGCCCCGCAGTTTGTCGATCTGCAGTCCGCCGAAGGTGGATTCACG
ACGTCGCTTGGAAAGTTTCAGGCTGGATGGTCAAAGACAGACAAGGGGTACACGCTCGACTTTACAGTTCCGCAC
GGGACACAGGGGAACCTCACGCTGCCGTTCGTCAGTGCCGCGAAGCCATCTATCAAGATCGACGGGACGGAGATC
AGCCGGGGAGTGCAGTATGCCAACTCGACGGCGACCGTGACGGTCAGCGGAGGAGGAACGTACAAGGTGGAGGTG
CAGTAG
Gene >Ani_SJS72_1|g8842.t1
ATGCGCTGGCACAAGCTCTTGCCGGGCGTGCTCGCTCTGCTCCCTCTCTCAGTTGCTCAAAGCTGTTGGCGCAAC
ACCACTTGTTCTGGTCCGACCGAAAGCGCTTTCTCCGGGCCATGGGAGAAAAACATTTTCGCGCCGTCCTCGAGA
ACCGTTAACCCTGAGAAGCTTTTTCTCATTACGCAGCCGGATAAGACGGAAGAGTATTCCCCATTTGCGCTTCAT
GGAAACGGTTCATTGGTGGTCTATGACTTCGGAAAAGAAGTTGGCGGCATTGTCTCCGTAAATTTCAGCTCCACA
GGCAGTGGTGCACTAGGAGTGGCATTTACCGAAGCGAAGAACTGGATTGGCGAGTGGTCGGATTCGTCGAATGGA
GGCTTCAAAGGCCCTGATGGTGCGCTCTACGGCAACTTCACCGAGGCCGGAAGTCACTACTATGTGATGCCGGAT
AAGAGCTTGCGTGGTGGATTTCGTTATCTGACTCTTTTCTTGATCACCAGCGACAACTCCACCATCCAAATCGAG
GATGTGAACTTGGAGATCGGCTTTCAGCCTACCTGGTCCAATTTGAAGGCCTACCAGGGGTACTTCCATTCCAAT
GACGATTTGCTCAACAAGATCTGGTACACTGGTGCCTACACTCTGCAGACGAACGAGGTGCCGACCGACACGGGA
CGGCAGATCCCAGCGATGGCCGTAGGCTGGGCGAATAATTGCACCCTTGGACCTGGCGATACGATCATTGTCGAC
GGAGCGAAGCGTGACCGTGCAGTGTGGCCGGGTGACATGGGGATTGCTGTCCCTTCCGCGTTTGTGAGTTTGGGC
GACTTGGACAGTGTCAAGAATGCGCTGCAGGTTATGTATGACACGCAGGTAAGATCACATCAAAACGACAGTACT
ATTGCTCGGATACTAACGCTATGCAGAACAACTCGACAGGTGCATTCGACGAGTCTGGCCCACCGCTGAGCCAGA
AAGACTCGGATACATACCACATGTGGACAATGGTGGGGACCTACAACTACATGCTTTTTACCAATGACAGCGACT
TCCTCGAGCGAAACTGGGAGGGATATCAGAAGGCCATGGACTACATCTACGGTAAGGTGACTTATCCCAGCGGCT
TGCTGAATGTCACGGGTACTCGCGACTGGGCCAGATGGCAGCAAGGATACAACAACTCCGAGGCGCAGATGATGT
AGGTCATTCCTACCCTTGCATTTATCCCCATCTAATGATCTCAGTTTGTATCACACCCTCAACACAGGCGCGGAG
CTCGCCACCTGGGCTGGAGATTCAGGCGACCTGTCCAGCACCTGGACCAGCCGGGCGGAGAAGCTGCGTCAAGCC
ATTAACGAATACTGCTGGGATGACTCGTACGGCGCATTCAAAGACAACGCCACCGACACCACCCTGCACCCTCAA
GACGCGAACAGCATGGCCCTGCTCTTCGGGGTCGTGGATGCGGACCGGGCCGCCAGCATTTCTGAAAGACTAACG
GACAACTGGACCCCAATTGGAGCCGTGGCACCCGAACTGCCAGAGAATATCTCGCCGTTCATCTCATCGTTCGAG
ATCCAGGGCCATCTGACCGTGGGGCAGCCACAACGAGCACTGGAGCTAATCCGCCGCAGCTGGGGATGGTACTAC
AACAATGCGAACGGCACACAGAGCACAGTCATCGAAGGCTATCTACAGAACGGCACGTTCGGCTACCGCTCTGAC
CGCGGGTACTACTATGACACGGCATATGTGTCACACTCGCACGGTTGGTCTTCAGGACCGACGTCGGCGCTGACG
AACTACATCGTGGGGATCAGTGTCACATCTCCACTGGGGGCGACCTGGCGCATTGCCCCGCAGTTTGTCGATCTG
CAGTCCGCCGAAGGTGGATTCACGACGTCGCTTGGAAAGTTTCAGGCTGGATGGTCAAAGACAGACAAGGGGTAC
ACGCTCGACTTTACAGTTCCGCACGGGACACAGGGGAACCTCACGCTGCCGTTCGTCAGTGCCGCGAAGCCATCT
ATCAAGATCGACGGGACGGAGATCAGCCGGGGAGTGCAGTATGCCAACTCGACGGCGACCGTGACGGTCAGCGGA
GGAGGAACGTACAAGGTGGAGGTGCAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail