Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g8359.t1
Gene name
Locationscaffold_076:136589..137890
Strand-
Gene length (bp)1301
Transcript length (bp)1083
Coding sequence length (bp)1083
Protein length (aa) 361

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18 4.3E-21 31 316

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g8359.t1
MTLLKNILAFSMGLASLGGAYAKLDLSSSNNVVVYWGQNSYAGTGSLAQQNLGYYCDDSNIDAIVLAFVMNVNGP
GGAPAYDFSLTSKNCTLFEGTNLPNCPQIGADITTCQKKGKTIILSIGGATYSEGGFQSQSAAQSGADLIWQTFG
PQQSNSTAHRPFGNASVDGFDLDFEATVNNMAPFANRLRQLFDAEPSKQYFLTAAPQCPYPDLADQQFLNGPVSM
DAVWVQFYNNPCGLGSFVQGQSTQSTFNFDQWDNWAKNVSQNPNVRVMLGVPANTGAAGSGYVPVSQLQSIIQYT
KTFKSFGGVMMWDVTQAYANSGFLSGVRSALGQTASRVFGTPYRYPLHLWGPESSTNWKK*
Coding >Ani_SJS72_1|g8359.t1
ATGACGCTCCTTAAAAACATTCTTGCCTTTTCGATGGGGCTGGCTTCTCTGGGAGGAGCATACGCCAAGCTCGAC
TTGTCTTCCTCTAACAACGTGGTTGTGTACTGGGGCCAAAATTCCTATGCAGGAACCGGAAGCTTGGCCCAGCAG
AACCTGGGCTATTACTGCGATGACAGCAATATTGATGCCATTGTCCTTGCGTTTGTGATGAACGTCAACGGACCT
GGAGGAGCACCAGCATACGACTTTTCGCTCACCAGTAAAAATTGCACGCTGTTCGAAGGCACCAACTTGCCGAAT
TGTCCCCAAATTGGTGCCGATATCACCACGTGCCAGAAGAAGGGGAAGACCATCATCCTGTCAATTGGCGGTGCG
ACGTACAGTGAAGGTGGATTCCAGTCGCAATCTGCTGCTCAATCCGGTGCCGACCTGATCTGGCAGACTTTCGGC
CCCCAGCAGTCCAACTCGACGGCGCATCGGCCCTTTGGCAACGCATCGGTGGACGGGTTTGATCTCGATTTCGAG
GCTACTGTGAATAACATGGCGCCGTTCGCGAACCGCCTTCGTCAACTGTTCGATGCCGAGCCCTCGAAACAATAC
TTTCTGACGGCAGCGCCGCAGTGCCCTTACCCCGACCTTGCCGACCAGCAGTTCCTCAACGGGCCGGTGTCAATG
GATGCCGTCTGGGTTCAGTTCTACAACAACCCTTGCGGGTTGGGCTCATTTGTTCAGGGTCAAAGCACGCAGTCG
ACCTTCAACTTTGATCAGTGGGACAACTGGGCCAAGAACGTGTCTCAGAACCCCAATGTGCGAGTGATGCTCGGC
GTTCCGGCCAATACCGGGGCAGCCGGCTCGGGCTATGTACCGGTCTCGCAACTGCAGTCGATCATTCAGTATACC
AAGACCTTCAAGAGCTTTGGCGGCGTGATGATGTGGGATGTCACGCAGGCGTACGCCAACTCGGGCTTCTTGAGT
GGCGTCCGCAGTGCTCTGGGGCAAACGGCCTCGCGGGTTTTTGGGACTCCATACCGGTACCCCCTGCACTTGTGG
GGCCCTGAATCCAGCACTAACTGGAAGAAATGA
Transcript >Ani_SJS72_1|g8359.t1
ATGACGCTCCTTAAAAACATTCTTGCCTTTTCGATGGGGCTGGCTTCTCTGGGAGGAGCATACGCCAAGCTCGAC
TTGTCTTCCTCTAACAACGTGGTTGTGTACTGGGGCCAAAATTCCTATGCAGGAACCGGAAGCTTGGCCCAGCAG
AACCTGGGCTATTACTGCGATGACAGCAATATTGATGCCATTGTCCTTGCGTTTGTGATGAACGTCAACGGACCT
GGAGGAGCACCAGCATACGACTTTTCGCTCACCAGTAAAAATTGCACGCTGTTCGAAGGCACCAACTTGCCGAAT
TGTCCCCAAATTGGTGCCGATATCACCACGTGCCAGAAGAAGGGGAAGACCATCATCCTGTCAATTGGCGGTGCG
ACGTACAGTGAAGGTGGATTCCAGTCGCAATCTGCTGCTCAATCCGGTGCCGACCTGATCTGGCAGACTTTCGGC
CCCCAGCAGTCCAACTCGACGGCGCATCGGCCCTTTGGCAACGCATCGGTGGACGGGTTTGATCTCGATTTCGAG
GCTACTGTGAATAACATGGCGCCGTTCGCGAACCGCCTTCGTCAACTGTTCGATGCCGAGCCCTCGAAACAATAC
TTTCTGACGGCAGCGCCGCAGTGCCCTTACCCCGACCTTGCCGACCAGCAGTTCCTCAACGGGCCGGTGTCAATG
GATGCCGTCTGGGTTCAGTTCTACAACAACCCTTGCGGGTTGGGCTCATTTGTTCAGGGTCAAAGCACGCAGTCG
ACCTTCAACTTTGATCAGTGGGACAACTGGGCCAAGAACGTGTCTCAGAACCCCAATGTGCGAGTGATGCTCGGC
GTTCCGGCCAATACCGGGGCAGCCGGCTCGGGCTATGTACCGGTCTCGCAACTGCAGTCGATCATTCAGTATACC
AAGACCTTCAAGAGCTTTGGCGGCGTGATGATGTGGGATGTCACGCAGGCGTACGCCAACTCGGGCTTCTTGAGT
GGCGTCCGCAGTGCTCTGGGGCAAACGGCCTCGCGGGTTTTTGGGACTCCATACCGGTACCCCCTGCACTTGTGG
GGCCCTGAATCCAGCACTAACTGGAAGAAATGA
Gene >Ani_SJS72_1|g8359.t1
ATGACGCTCCTTAAAAACATTCTTGCCTTTTCGATGGGGCTGGCTTCTCTGGGAGGAGCATACGCCAAGCTCGAC
TTGTCTTCCTCTAACAACGTGGTTGTGTACTGGGGTGAGTATCCACCCTATGCCAGAGTCTGACCGTAGTTGACA
TGTCTGCGATTAGGCCAAAATTCCTATGCAGGAACCGGAAGCTTGGCCCAGCAGAACCTGGGCTATTACTGCGAT
GGTGAGTGTTCCGCAATCCTCGGAAGAAGAAGCTGTGCTGACTCGAAATTTAGACAGCAATATTGATGTAAGATC
AAGCTTCGACTAGAGAAAATGCATATGAATGAGATGCTAACCACCGTCAAGGCCATTGTCCTTGCGTTTGTGATG
AACGTCAACGGACCTGGAGGAGCACCAGCATACGACTTTTCGCTCACCAGTAAAAATTGCACGCTGTTCGAAGGC
ACCAACTTGCCGAATTGTCCCCAAATTGGGTATGCTTCATGTTCTCGGAACTGAAGGCAACACGGCTAATACAAT
GATGCAGTGCCGATATCACCACGTGCCAGAAGAAGGGGAAGACCATCATCCTGTCAATTGGCGGTGCGACGTACA
GTGAAGGTGGATTCCAGTCGCAATCTGCTGCTCAATCCGGTGCCGACCTGATCTGGCAGACTTTCGGCCCCCAGC
AGTCCAACTCGACGGCGCATCGGCCCTTTGGCAACGCATCGGTGGACGGGTTTGATCTCGATTTCGAGGCTACTG
TGAATAACATGGCGCCGTTCGCGAACCGCCTTCGTCAACTGTTCGATGCCGAGCCCTCGAAACAATACTTTCTGA
CGGCAGCGCCGCAGTGCCCTTACCCCGACCTTGCCGACCAGCAGTTCCTCAACGGGCCGGTGTCAATGGATGCCG
TCTGGGTTCAGTTCTACAACAACCCTTGCGGGTTGGGCTCATTTGTTCAGGGTCAAAGCACGCAGTCGACCTTCA
ACTTTGATCAGTGGGACAACTGGGCCAAGAACGTGTCTCAGAACCCCAATGTGCGAGTGATGCTCGGCGTTCCGG
CCAATACCGGGGCAGCCGGCTCGGGCTATGTACCGGTCTCGCAACTGCAGTCGATCATTCAGTATACCAAGACCT
TCAAGAGCTTTGGCGGCGTGATGATGTGGGATGTCACGCAGGCGTACGCCAACTCGGGCTTCTTGAGTGGCGTCC
GCAGTGCTCTGGGGCAAACGGCCTCGCGGGTTTTTGGGACTCCATACCGGTACCCCCTGCACTTGTGGGGCCCTG
AATCCAGCACTAACTGGAAGAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail