Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g8245.t1
Gene name
Locationscaffold_074:112275..113163
Strand+
Gene length (bp)888
Transcript length (bp)732
Coding sequence length (bp)732
Protein length (aa) 244

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01522 Polysacc_deac_1 Polysaccharide deacetylase 4.5E-28 45 163
PF03065 Glyco_hydro_57 Glycosyl hydrolase family 57 3.9E-06 100 164

GO

GO Term Description Terminal node
GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0003824 catalytic activity Yes
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0016787 hydrolase activity No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g8245.t1
MTKLLAITLILTILSLLPTCYSHPINETSHSSAVPYGMLITHCTVPNTIALTFDDGPSTFTPALLDLLSEYGARS
TFFVNGYRLQESAPILQRIYTEGHQIASHTFGHSFLPTLDNPTIINEMNTLESLFRTFIGRVPTYMRPPFLAVDG
RILALMTDLEYHVIGASVDTKDFENNTPQLIGESVRKFVEGVQAGGTVVLAHDTHAQTVWTLTRVMLEESRRRGL
IATTVADCLGEPMDFWYR*
Coding >Ani_SJS72_1|g8245.t1
ATGACCAAGCTCCTAGCAATCACCCTCATCCTCACCATCCTCTCCCTGCTTCCAACCTGCTACAGCCACCCCATC
AACGAAACCTCCCACTCCTCAGCCGTCCCCTACGGCATGCTAATCACCCACTGCACCGTCCCCAACACCATCGCC
CTAACCTTCGACGACGGCCCCTCAACCTTCACCCCAGCCCTTCTGGACCTCCTCAGCGAATACGGGGCACGCTCA
ACCTTCTTCGTGAACGGCTACCGACTACAGGAGAGTGCTCCCATCCTACAACGCATCTACACTGAAGGGCACCAA
ATAGCCTCTCACACATTTGGCCACTCCTTCCTCCCTACCCTCGACAACCCCACCATAATTAACGAGATGAACACC
CTCGAGTCCTTATTCCGGACCTTCATCGGTCGAGTCCCCACCTATATGCGCCCGCCCTTCCTAGCTGTGGACGGA
AGAATCCTCGCATTGATGACGGACTTGGAATACCATGTTATTGGGGCAAGTGTAGACACAAAGGACTTTGAGAAT
AATACGCCTCAGTTAATAGGGGAGAGTGTGAGGAAGTTTGTGGAGGGGGTGCAGGCGGGCGGGACGGTGGTGTTG
GCACATGATACGCATGCGCAGACGGTTTGGACTTTGACTAGGGTTATGTTGGAGGAGAGTAGGAGGAGGGGGTTG
ATTGCTACGACCGTGGCGGATTGCTTGGGGGAGCCGATGGATTTTTGGTACCGTTAG
Transcript >Ani_SJS72_1|g8245.t1
ATGACCAAGCTCCTAGCAATCACCCTCATCCTCACCATCCTCTCCCTGCTTCCAACCTGCTACAGCCACCCCATC
AACGAAACCTCCCACTCCTCAGCCGTCCCCTACGGCATGCTAATCACCCACTGCACCGTCCCCAACACCATCGCC
CTAACCTTCGACGACGGCCCCTCAACCTTCACCCCAGCCCTTCTGGACCTCCTCAGCGAATACGGGGCACGCTCA
ACCTTCTTCGTGAACGGCTACCGACTACAGGAGAGTGCTCCCATCCTACAACGCATCTACACTGAAGGGCACCAA
ATAGCCTCTCACACATTTGGCCACTCCTTCCTCCCTACCCTCGACAACCCCACCATAATTAACGAGATGAACACC
CTCGAGTCCTTATTCCGGACCTTCATCGGTCGAGTCCCCACCTATATGCGCCCGCCCTTCCTAGCTGTGGACGGA
AGAATCCTCGCATTGATGACGGACTTGGAATACCATGTTATTGGGGCAAGTGTAGACACAAAGGACTTTGAGAAT
AATACGCCTCAGTTAATAGGGGAGAGTGTGAGGAAGTTTGTGGAGGGGGTGCAGGCGGGCGGGACGGTGGTGTTG
GCACATGATACGCATGCGCAGACGGTTTGGACTTTGACTAGGGTTATGTTGGAGGAGAGTAGGAGGAGGGGGTTG
ATTGCTACGACCGTGGCGGATTGCTTGGGGGAGCCGATGGATTTTTGGTACCGTTAG
Gene >Ani_SJS72_1|g8245.t1
ATGACCAAGCTCCTAGCAATCACCCTCATCCTCACCATCCTCTCCCTGCTTCCAACCTGCTACAGCCACCCCATC
AACGAAACCTCCCACTCCTCAGCCGTCCCCTACGGCATGCTAATCACCCACTGCACCGTCCCCAACACCATCGCC
CTAACCTTCGACGACGGCCCCTCAACCTTCACCCCAGCCCTTCTGGACCTCCTCAGCGAATACGGGGCACGCTCA
ACCTTCTTCGTGAACGGCTACCGACTACAGGAGAGTGCTCCCATCCTACAACGCATCTACACTGAAGGGCACCAA
ATAGCCTCTCACACGTAAGTCTCCCCAGTCTCGCTACTATCTCCATGAAACCGAACCCCTCGAACCAAATACCCT
GATATATATTCATCACTAGATTTGGCCACTCCTTCCTCCCTACCCTCGACAACCCCACCATAATTAACGAGATGA
ACACCCTCGAGTCCTTATTCCGGACCTTCATCGGTCGAGTCCCCACCTATATGCGCCCGCCCTTCCTAGCTGTGG
ACGGAAGAATCCTCGCATTGATGACGGACTTGGAATACCATGTTATTGGGGCAAGTGTAGACACAAAGGACTTTG
AGAATAATACGCCTCAGTTAATAGGGGAGAGTGTGAGGAAGTTTGTGGAGGGGGTGCAGGCGGGCGGGACGGTGG
TGTTGGCACATGATACGCATGCGCAGACGGTTTGGACTTTGACTAGGGTTATGTTGGAGGAGAGTAGGAGGAGGG
GGTTGATTGGTAGGTTTACCCCTCCTTGACTTTTACTTGGGATGTGTTGTGAGTAGACGGTGGTGCTAATGGTTG
GTTTGTTTAGCTACGACCGTGGCGGATTGCTTGGGGGAGCCGATGGATTTTTGGTACCGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail