Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g8120.t1
Gene name
Locationscaffold_072:61258..63103
Strand-
Gene length (bp)1845
Transcript length (bp)1638
Coding sequence length (bp)1638
Protein length (aa) 546

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02128 Peptidase_M36 Fungalysin metallopeptidase (M36) 1.8E-129 219 545
PF07504 FTP Fungalysin/Thermolysin Propeptide Motif 1.5E-13 80 131

GO

GO Term Description Terminal node
GO:0004222 metalloendopeptidase activity Yes
GO:0005615 extracellular space Yes
GO:0008270 zinc ion binding Yes
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0008237 metallopeptidase activity No
GO:0005488 binding No
GO:0016787 hydrolase activity No
GO:0046914 transition metal ion binding No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0110165 cellular anatomical entity No
GO:0008233 peptidase activity No
GO:0004175 endopeptidase activity No
GO:0005575 cellular_component No
GO:0140096 catalytic activity, acting on a protein No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g8120.t1
MHGLRLVCSIGALPLAILAYPAASLHTNPVSADLDSLRLTSNSEYVNSVHVNMNLSVAVSAEEHYTDTAARLLQN
IVPGASFRLIDDHFVGDNGVAHVYLRQTLHGNDIDNADFNVNIGKDGLVLSFGHSFFTGALPSSYLDNPNVLEAA
DGRNEYIFREVVGAVSDPKAKLVYLVKPEGTLALTWRIETDMYEHWLLTYIDAENTTVHGVVDYVADATYQVYPW
GINDPAEGHRTIVTDPWDLSASAYTWISDGRDNYTTTRGNNAIAHWNPTGGGSYLYNLRPSDPNLNFQWPYSPNM
SPPRSYINASIVQLFYTANTYHDLLYTLGFTESAGNFQWNNSAHGGRDKDYVILNAQDGSGFSNANFATPPDGIP
GRMRMYIWIESTPSRDGSFDAGIVIHEYTHGVSNRLTGGSHNAGCLSTLESGGMGEGWGDFMATAIRIKPNDTRT
TSYTMGAWADNDKRGVRDYPYSTSFAENPLNYTSVNTMNGVHAIGTVWATMMYEVLWNLIDKYGKNDGSRPVFRN
GVPTDGKYLMMKLVMDGMAL*
Coding >Ani_SJS72_1|g8120.t1
ATGCATGGTCTGCGCCTAGTCTGTAGCATAGGGGCATTGCCTTTGGCTATCCTGGCATATCCTGCGGCTTCATTA
CATACAAATCCAGTCTCCGCGGACTTGGACTCCCTGCGTTTGACCTCTAACTCCGAATACGTCAATTCTGTCCAT
GTAAACATGAATTTATCAGTCGCAGTGTCCGCAGAAGAACATTATACCGATACAGCAGCTCGACTGCTTCAGAAC
ATTGTTCCTGGAGCGAGCTTTCGTCTTATCGATGACCACTTTGTCGGCGACAATGGAGTTGCACATGTATACTTG
CGCCAAACGCTCCATGGTAATGACATTGACAATGCGGATTTCAATGTTAATATTGGAAAAGACGGGCTGGTTTTG
TCTTTCGGACATTCGTTCTTTACAGGCGCGTTGCCGAGCAGCTATCTGGACAATCCCAACGTTTTAGAAGCTGCT
GATGGGCGGAACGAGTACATTTTCAGAGAGGTAGTGGGAGCGGTATCTGACCCCAAAGCTAAGCTAGTCTACCTT
GTCAAGCCAGAAGGGACTCTGGCGCTCACCTGGAGGATAGAAACAGACATGTATGAGCACTGGCTACTGACATAC
ATTGATGCAGAGAATACCACTGTCCACGGCGTGGTTGACTATGTCGCAGACGCAACATATCAAGTATATCCCTGG
GGCATAAACGATCCAGCAGAAGGACATCGCACCATTGTCACCGACCCCTGGGACCTATCCGCATCCGCATACACC
TGGATAAGCGATGGACGGGACAACTACACCACAACCAGAGGCAACAATGCCATCGCACACTGGAATCCGACCGGC
GGTGGCTCCTATCTCTACAACCTACGCCCATCCGACCCCAACTTGAACTTCCAATGGCCATACTCCCCAAACATG
TCCCCACCCCGATCATACATCAACGCCTCCATCGTCCAACTCTTCTACACAGCAAACACCTACCACGACCTCCTC
TATACACTTGGATTTACTGAATCCGCCGGCAACTTCCAATGGAACAACAGCGCCCACGGCGGCCGGGACAAAGAC
TACGTGATCCTCAACGCACAAGACGGCTCAGGGTTCAGCAACGCAAACTTTGCAACTCCACCCGATGGTATCCCC
GGCCGTATGCGCATGTACATCTGGATCGAGTCCACTCCGTCGCGTGATGGAAGTTTTGACGCGGGCATTGTAATT
CACGAATACACTCACGGTGTATCGAATCGTCTCACCGGCGGCTCCCATAACGCCGGATGCCTCAGCACCCTCGAA
TCGGGTGGTATGGGCGAAGGCTGGGGCGACTTTATGGCGACGGCCATCCGAATCAAGCCCAACGATACACGCACA
ACGTCCTACACTATGGGTGCATGGGCAGACAACGATAAGCGCGGTGTCCGCGACTATCCCTACTCTACTTCGTTT
GCCGAAAACCCTCTGAACTACACGAGCGTAAATACCATGAACGGCGTGCACGCCATCGGAACTGTCTGGGCAACC
ATGATGTACGAGGTCTTGTGGAACCTCATCGACAAGTACGGGAAGAATGATGGGTCGAGGCCGGTGTTTAGAAAC
GGGGTGCCTACAGATGGAAAGTATTTGATGATGAAGTTGGTGATGGATGGGATGGCACTGTAA
Transcript >Ani_SJS72_1|g8120.t1
ATGCATGGTCTGCGCCTAGTCTGTAGCATAGGGGCATTGCCTTTGGCTATCCTGGCATATCCTGCGGCTTCATTA
CATACAAATCCAGTCTCCGCGGACTTGGACTCCCTGCGTTTGACCTCTAACTCCGAATACGTCAATTCTGTCCAT
GTAAACATGAATTTATCAGTCGCAGTGTCCGCAGAAGAACATTATACCGATACAGCAGCTCGACTGCTTCAGAAC
ATTGTTCCTGGAGCGAGCTTTCGTCTTATCGATGACCACTTTGTCGGCGACAATGGAGTTGCACATGTATACTTG
CGCCAAACGCTCCATGGTAATGACATTGACAATGCGGATTTCAATGTTAATATTGGAAAAGACGGGCTGGTTTTG
TCTTTCGGACATTCGTTCTTTACAGGCGCGTTGCCGAGCAGCTATCTGGACAATCCCAACGTTTTAGAAGCTGCT
GATGGGCGGAACGAGTACATTTTCAGAGAGGTAGTGGGAGCGGTATCTGACCCCAAAGCTAAGCTAGTCTACCTT
GTCAAGCCAGAAGGGACTCTGGCGCTCACCTGGAGGATAGAAACAGACATGTATGAGCACTGGCTACTGACATAC
ATTGATGCAGAGAATACCACTGTCCACGGCGTGGTTGACTATGTCGCAGACGCAACATATCAAGTATATCCCTGG
GGCATAAACGATCCAGCAGAAGGACATCGCACCATTGTCACCGACCCCTGGGACCTATCCGCATCCGCATACACC
TGGATAAGCGATGGACGGGACAACTACACCACAACCAGAGGCAACAATGCCATCGCACACTGGAATCCGACCGGC
GGTGGCTCCTATCTCTACAACCTACGCCCATCCGACCCCAACTTGAACTTCCAATGGCCATACTCCCCAAACATG
TCCCCACCCCGATCATACATCAACGCCTCCATCGTCCAACTCTTCTACACAGCAAACACCTACCACGACCTCCTC
TATACACTTGGATTTACTGAATCCGCCGGCAACTTCCAATGGAACAACAGCGCCCACGGCGGCCGGGACAAAGAC
TACGTGATCCTCAACGCACAAGACGGCTCAGGGTTCAGCAACGCAAACTTTGCAACTCCACCCGATGGTATCCCC
GGCCGTATGCGCATGTACATCTGGATCGAGTCCACTCCGTCGCGTGATGGAAGTTTTGACGCGGGCATTGTAATT
CACGAATACACTCACGGTGTATCGAATCGTCTCACCGGCGGCTCCCATAACGCCGGATGCCTCAGCACCCTCGAA
TCGGGTGGTATGGGCGAAGGCTGGGGCGACTTTATGGCGACGGCCATCCGAATCAAGCCCAACGATACACGCACA
ACGTCCTACACTATGGGTGCATGGGCAGACAACGATAAGCGCGGTGTCCGCGACTATCCCTACTCTACTTCGTTT
GCCGAAAACCCTCTGAACTACACGAGCGTAAATACCATGAACGGCGTGCACGCCATCGGAACTGTCTGGGCAACC
ATGATGTACGAGGTCTTGTGGAACCTCATCGACAAGTACGGGAAGAATGATGGGTCGAGGCCGGTGTTTAGAAAC
GGGGTGCCTACAGATGGAAAGTATTTGATGATGAAGTTGGTGATGGATGGGATGGCACTGTAA
Gene >Ani_SJS72_1|g8120.t1
ATGCATGGTCTGCGCCTAGTCTGTAGCATAGGGGCATTGCCTTTGGCTATCCTGGCATATCCTGCGGCTTCATTA
CATACAAATCCAGTCTCCGCGGACTTGGACTCCCTGCGTTTGACCTCTAACTCCGAATACGTCAATTCTGTCCAT
GTAAACATGAATTTATCAGTCGCAGTGTCCGCAGAAGAACATTATACCGATACAGCAGCTCGACTGCTTCAGAAC
ATTGTTCCTGGAGCGAGCTTTCGTCTTATCGATGACCACTTTGTCGGCGACAATGGAGTTGCACATGTATACTTG
CGCCAAACGCTCCATGGTAATGACATTGACAATGCGGATTTCAATGTTAATGTCTGCTCCCCAATTACTTTGTCC
GAAAGGAAGCTTACTGTTACAGATTGGAAAAGACGGGCTGGTTTTGTCTTTCGGACATTCGTTCTTTACAGGCGC
GTTGCCGAGCAGCTATCTGGACAATCCCAACGTTTTAGGTCCGGGGGCTGCACTTAGAGGAGCAAGGGACGCTTT
ACAGCTTCCACTGACTATTGACAATGTTTCTACAGAAGCTGCTGATGGGCGGAACGAGTACATTTTCAGAGAGGT
AGTGGGAGCGGTATCTGACCCCAAAGCTAAGCTAGTCTACCTTGTCAAGCCAGAAGGGACTCTGGCGCTCACCTG
GAGGATAGAAACAGACATGTATGAGCACTGGCTACTGACATACATTGATGCAGAGAATACCACTGTCCACGGCGT
GGTTGACTATGTCGCAGACGCAACATATCAAGTATAGTGAGTGGTTCTCCCCATCGAATAACGAAGCTAAGACAA
CAGTCCCTGGGGCATAAACGATCCAGCAGAAGGACATCGCACCATTGTCACCGACCCCTGGGACCTATCCGCATC
CGCATACACCTGGATAAGCGATGGACGGGACAACTACACCACAACCAGAGGCAACAATGCCATCGCACACTGGAA
TCCGACCGGCGGTGGCTCCTATCTCTACAACCTACGCCCATCCGACCCCAACTTGAACTTCCAATGGCCATACTC
CCCAAACATGTCCCCACCCCGATCATACATCAACGCCTCCATCGTCCAACTCTTCTACACAGCAAACACCTACCA
CGACCTCCTCTATACACTTGGATTTACTGAATCCGCCGGCAACTTCCAATGGAACAACAGCGCCCACGGCGGCCG
GGACAAAGACTACGTGATCCTCAACGCACAAGACGGCTCAGGGTTCAGCAACGCAAACTTTGCAACTCCACCCGA
TGGTATCCCCGGCCGTATGCGCATGTACATCTGGATCGAGTCCACTCCGTCGCGTGATGGAAGTTTTGACGCGGG
CATTGTAATTCACGAATACACTCACGGTGGTAAGCCACTTCCCTTACCATTTAAACAAATCCATCTAACAAACCA
GTATCGAATCGTCTCACCGGCGGCTCCCATAACGCCGGATGCCTCAGCACCCTCGAATCGGGTGGTATGGGCGAA
GGCTGGGGCGACTTTATGGCGACGGCCATCCGAATCAAGCCCAACGATACACGCACAACGTCCTACACTATGGGT
GCATGGGCAGACAACGATAAGCGCGGTGTCCGCGACTATCCCTACTCTACTTCGTTTGCCGAAAACCCTCTGAAC
TACACGAGCGTAAATACCATGAACGGCGTGCACGCCATCGGAACTGTCTGGGCAACCATGATGTACGAGGTCTTG
TGGAACCTCATCGACAAGTACGGGAAGAATGATGGGTCGAGGCCGGTGTTTAGAAACGGGGTGCCTACAGATGGA
AAGTATTTGATGATGAAGTTGGTGATGGATGGGATGGCACTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail