Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g8096.t1
Gene name
Locationscaffold_071:168539..169060
Strand+
Gene length (bp)521
Transcript length (bp)414
Coding sequence length (bp)414
Protein length (aa) 138

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00545 Ribonuclease ribonuclease 9.9E-08 55 132

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0004521 endoribonuclease activity Yes
GO:0003676 nucleic acid binding No
GO:0003824 catalytic activity No
GO:0004519 endonuclease activity No
GO:0004518 nuclease activity No
GO:1901363 heterocyclic compound binding No
GO:0016787 hydrolase activity No
GO:0004540 ribonuclease activity No
GO:0003674 molecular_function No
GO:0140098 catalytic activity, acting on RNA No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0097159 organic cyclic compound binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g8096.t1
MFQLKTILLSLPLLLTTTLAAPSTSLDTRSDSKCVYYCGSHCYWASDISKAQAKGYSLHEEGRTIDDYPHVYHDY
EGFDFTVSGTYYEYPILDDYKVYDGGSPGADRIIFNGEDEFAGLITHTGAEEYDGFVACEAV*
Coding >Ani_SJS72_1|g8096.t1
ATGTTCCAACTCAAGACTATCCTCCTCTCCCTCCCCCTCCTCCTCACAACCACGCTCGCCGCCCCCTCCACTTCG
CTCGATACCCGCTCCGACTCCAAATGCGTCTACTACTGCGGCAGCCACTGCTACTGGGCCAGCGACATCAGCAAA
GCGCAAGCAAAGGGATACTCGCTACACGAAGAAGGGCGCACGATCGACGACTACCCGCACGTCTACCACGACTAC
GAAGGATTCGACTTCACCGTCTCGGGCACATACTACGAGTACCCGATTCTGGATGATTACAAGGTGTATGATGGA
GGGTCTCCCGGTGCGGATCGGATCATTTTCAATGGGGAGGATGAGTTTGCGGGGTTGATTACGCATACGGGCGCG
GAGGAATATGATGGGTTTGTGGCTTGTGAGGCTGTTTAG
Transcript >Ani_SJS72_1|g8096.t1
ATGTTCCAACTCAAGACTATCCTCCTCTCCCTCCCCCTCCTCCTCACAACCACGCTCGCCGCCCCCTCCACTTCG
CTCGATACCCGCTCCGACTCCAAATGCGTCTACTACTGCGGCAGCCACTGCTACTGGGCCAGCGACATCAGCAAA
GCGCAAGCAAAGGGATACTCGCTACACGAAGAAGGGCGCACGATCGACGACTACCCGCACGTCTACCACGACTAC
GAAGGATTCGACTTCACCGTCTCGGGCACATACTACGAGTACCCGATTCTGGATGATTACAAGGTGTATGATGGA
GGGTCTCCCGGTGCGGATCGGATCATTTTCAATGGGGAGGATGAGTTTGCGGGGTTGATTACGCATACGGGCGCG
GAGGAATATGATGGGTTTGTGGCTTGTGAGGCTGTTTAG
Gene >Ani_SJS72_1|g8096.t1
ATGTTCCAACTCAAGGTACACCCATCCCATACCAACCTCATCACACTCACACACACACACACACACACACACCCA
TTCTTCACAAATCACCAACAACAAACCAACCAAAACATCTAATCTAGACTATCCTCCTCTCCCTCCCCCTCCTCC
TCACAACCACGCTCGCCGCCCCCTCCACTTCGCTCGATACCCGCTCCGACTCCAAATGCGTCTACTACTGCGGCA
GCCACTGCTACTGGGCCAGCGACATCAGCAAAGCGCAAGCAAAGGGATACTCGCTACACGAAGAAGGGCGCACGA
TCGACGACTACCCGCACGTCTACCACGACTACGAAGGATTCGACTTCACCGTCTCGGGCACATACTACGAGTACC
CGATTCTGGATGATTACAAGGTGTATGATGGAGGGTCTCCCGGTGCGGATCGGATCATTTTCAATGGGGAGGATG
AGTTTGCGGGGTTGATTACGCATACGGGCGCGGAGGAATATGATGGGTTTGTGGCTTGTGAGGCTGTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail