Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g7873.t1
Gene name
Locationscaffold_067:151121..154091
Strand+
Gene length (bp)2970
Transcript length (bp)2676
Coding sequence length (bp)2676
Protein length (aa) 892

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01644 Chitin_synth_1 Chitin synthase 3.2E-69 202 370
PF08407 Chitin_synth_1N Chitin synthase N-terminal 4.7E-27 122 201
PF03142 Chitin_synth_2 Chitin synthase 2.8E-19 347 525

GO

GO Term Description Terminal node
GO:0006031 chitin biosynthetic process Yes
GO:0004100 chitin synthase activity Yes
GO:0006023 aminoglycan biosynthetic process No
GO:1901073 glucosamine-containing compound biosynthetic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0006022 aminoglycan metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0016758 hexosyltransferase activity No
GO:0009059 macromolecule biosynthetic process No
GO:0009058 biosynthetic process No
GO:0003674 molecular_function No
GO:0016757 glycosyltransferase activity No
GO:0071704 organic substance metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0003824 catalytic activity No
GO:0006030 chitin metabolic process No
GO:0008375 acetylglucosaminyltransferase activity No
GO:0046349 amino sugar biosynthetic process No
GO:0016740 transferase activity No
GO:0006040 amino sugar metabolic process No
GO:0043170 macromolecule metabolic process No
GO:1901071 glucosamine-containing compound metabolic process No
GO:0008194 UDP-glycosyltransferase activity No
GO:0006807 nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

Domain # Start End Length
1 520 539 19
2 562 584 22
3 604 626 22
4 638 660 22
5 687 709 22
6 716 738 22
7 818 840 22
8 853 875 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g7873.t1
MGTPTPYSAHSPRDSESSYFSHTSPPHGHQTYHSEEHEHDEQEQSLLERNNSSHYGTPFDDPAVSTDSLRRYTLH
DDGPAVFAAPPYQESEAASENTFRARSNGDKASREGSRAGALRRYGTRKINLVQGSVLSVDYPVPSAIQNAIQPQ
YRDAEEAFSEEFTHMRYTAATCDPDEFTLRNGYNLRPAIYNRHTELLIAITYYNEDKVLTARTLHGVMQNIRDIV
NLKKSEFWNKGGPAWQKIVVCLVFDGIEPCDKNTLDVLATIGIYQDGVMKKDVDGRETVAHVFEYTTQLSVTPTQ
QLIRPQGNESTNLPPVQMIFCLKQKNSKKINSHRWLFNAFSRILNPEVVILLDAGTKPGHKSLLALWEAFYNDKT
LGGACGEIHAMLGQGWRKVINPLVAAQNFEYKISNILDKPLESAFGYVSVLPGAFSAYRYRAIMGRPLEQYFHGD
HTLSKRLGKKGIDGMNIFKKNMFLAEDRILCFELVAKAGFKWHLSYVKASKGETDVPEGAAEFISQRRRWLNGSF
AAGLYAIMHFGRIYRSGHSIIRMFFLHIQMLYNVCQLIMTWFSLASYWLTSSVIMDLVGTPSTSNKNKGWPWGNE
ASPIVNNFVKYGYVWVLTLQFIMALGNRPKGVKIPYILSYLYFSLVQLYVLILSFYLVVGAFNGGMMDFNFDEGV
GTFLSSFFSSSGGGIVLIALVSTYGIYIIASVLYMDPWHIITSSWAYFLGMTTSINILMVYAFCNWHDVSWGTKG
SDKAEALPSAQTKKDDDNKQNFIEEIDKPQADIDSQFEATVKRALTPWIEPEEEGGKSLDDAYRNFRTVLVCLWV
FSNLLVTLLITATGVDKMCLTNTSTTRTSWYFEVILWITAGLSLFRFIGSLWFLGRSGILCCVSRR*
Coding >Ani_SJS72_1|g7873.t1
ATGGGTACGCCAACACCTTACTCGGCCCATTCGCCGCGGGACAGCGAAAGCAGCTACTTCTCCCACACGTCTCCC
CCCCATGGTCACCAAACTTACCACTCCGAGGAACATGAGCACGACGAGCAGGAACAGTCTCTGCTGGAGCGCAAC
AATTCCAGTCACTATGGCACGCCCTTCGATGATCCCGCCGTGTCGACAGACTCCCTCCGTCGCTACACTCTGCAC
GACGACGGTCCAGCGGTCTTCGCCGCGCCTCCTTACCAAGAATCCGAAGCCGCTTCCGAAAACACCTTCCGTGCC
CGGAGCAATGGCGACAAGGCTTCCCGTGAAGGGAGTCGCGCGGGTGCCCTGCGCCGTTACGGAACGAGAAAGATC
AACCTAGTGCAAGGTTCCGTTCTGAGTGTCGACTACCCGGTGCCGAGTGCCATTCAGAACGCCATCCAGCCTCAA
TACCGGGATGCGGAGGAGGCCTTTTCCGAAGAATTCACGCACATGAGATACACGGCCGCCACCTGTGATCCCGAC
GAGTTCACGCTGCGCAATGGCTACAATCTCCGGCCGGCTATCTACAACCGGCATACCGAATTGCTGATCGCCATC
ACCTACTACAACGAAGACAAGGTGTTGACCGCGCGTACCCTTCACGGTGTCATGCAGAACATCCGTGATATTGTC
AACTTGAAGAAATCCGAGTTCTGGAACAAGGGTGGCCCTGCTTGGCAGAAGATCGTGGTCTGTTTGGTTTTCGAT
GGTATTGAGCCATGCGACAAAAACACACTGGATGTGTTGGCGACGATTGGTATCTACCAGGATGGAGTCATGAAG
AAGGACGTTGACGGGCGGGAAACCGTCGCCCACGTTTTTGAATATACTACCCAATTGTCCGTCACTCCGACGCAG
CAGTTGATCCGGCCCCAGGGCAATGAGTCGACCAACTTGCCCCCCGTGCAGATGATCTTCTGTCTCAAGCAGAAG
AATAGCAAGAAGATCAACTCCCACCGTTGGCTGTTCAACGCCTTCAGTCGTATCTTGAACCCGGAAGTCGTCATT
CTGCTGGATGCCGGTACTAAGCCCGGACACAAATCTCTGCTTGCTCTGTGGGAGGCCTTCTACAATGACAAGACT
CTCGGTGGAGCCTGTGGTGAGATCCATGCAATGCTGGGTCAGGGCTGGCGCAAGGTCATCAATCCGTTAGTCGCT
GCGCAGAACTTTGAGTACAAGATCTCCAATATTCTCGATAAACCTCTGGAAAGTGCATTCGGTTATGTCAGTGTC
TTGCCTGGTGCATTCTCTGCCTATCGGTATCGCGCTATCATGGGCCGTCCCCTGGAGCAATACTTCCACGGAGAC
CATACGTTATCTAAGCGTCTTGGAAAGAAGGGTATTGACGGCATGAATATCTTCAAAAAGAACATGTTCTTGGCT
GAGGATCGTATTCTTTGCTTCGAATTGGTGGCCAAGGCTGGTTTCAAGTGGCATCTCAGTTACGTCAAGGCGTCC
AAGGGTGAGACCGATGTTCCGGAAGGTGCAGCCGAATTCATCAGTCAAAGACGTCGTTGGTTGAACGGTTCTTTC
GCTGCCGGTCTGTATGCCATCATGCATTTCGGCCGTATCTACCGCAGTGGTCACAGCATCATTCGCATGTTCTTC
CTGCATATTCAGATGCTCTACAACGTGTGTCAACTGATCATGACCTGGTTCTCACTTGCCTCTTACTGGCTCACT
AGTTCCGTCATCATGGATTTGGTGGGTACGCCGTCTACGAGTAACAAGAACAAGGGTTGGCCATGGGGCAACGAA
GCGTCGCCCATTGTCAACAACTTCGTCAAATACGGTTATGTCTGGGTTCTTACGCTGCAGTTTATCATGGCTTTG
GGTAATCGGCCGAAAGGTGTCAAGATCCCTTACATCCTATCCTACCTTTACTTCTCTCTTGTCCAGCTGTACGTC
CTCATCCTGTCGTTCTACCTGGTCGTGGGTGCCTTCAACGGTGGTATGATGGACTTCAACTTCGACGAAGGCGTC
GGCACATTCCTCTCCTCATTCTTCAGCTCCAGCGGTGGTGGTATCGTGCTGATCGCTTTGGTCTCCACTTACGGA
ATCTACATCATTGCTAGTGTCCTGTATATGGATCCCTGGCACATCATCACCAGTTCCTGGGCCTACTTCCTGGGT
ATGACGACCTCGATCAACATCTTGATGGTTTACGCGTTCTGTAACTGGCACGACGTTTCTTGGGGTACCAAGGGT
TCGGACAAGGCCGAGGCACTGCCTTCCGCGCAAACCAAAAAGGACGACGACAACAAGCAGAACTTCATCGAGGAA
ATCGACAAGCCGCAAGCCGATATCGACAGTCAGTTCGAGGCGACTGTGAAGAGAGCGTTGACGCCGTGGATCGAA
CCGGAGGAAGAGGGCGGCAAGAGTTTGGACGATGCCTACCGCAACTTCCGTACCGTGCTTGTGTGTCTGTGGGTG
TTTAGTAACTTGCTCGTAACGCTGTTGATCACCGCCACTGGAGTGGACAAGATGTGTCTGACGAACACCTCCACC
ACCCGTACATCCTGGTACTTCGAAGTCATTCTGTGGATTACGGCCGGTCTGTCGCTGTTCCGCTTCATCGGCTCG
TTGTGGTTCTTGGGCCGGTCGGGTATTCTGTGCTGTGTGTCCCGGCGCTAA
Transcript >Ani_SJS72_1|g7873.t1
ATGGGTACGCCAACACCTTACTCGGCCCATTCGCCGCGGGACAGCGAAAGCAGCTACTTCTCCCACACGTCTCCC
CCCCATGGTCACCAAACTTACCACTCCGAGGAACATGAGCACGACGAGCAGGAACAGTCTCTGCTGGAGCGCAAC
AATTCCAGTCACTATGGCACGCCCTTCGATGATCCCGCCGTGTCGACAGACTCCCTCCGTCGCTACACTCTGCAC
GACGACGGTCCAGCGGTCTTCGCCGCGCCTCCTTACCAAGAATCCGAAGCCGCTTCCGAAAACACCTTCCGTGCC
CGGAGCAATGGCGACAAGGCTTCCCGTGAAGGGAGTCGCGCGGGTGCCCTGCGCCGTTACGGAACGAGAAAGATC
AACCTAGTGCAAGGTTCCGTTCTGAGTGTCGACTACCCGGTGCCGAGTGCCATTCAGAACGCCATCCAGCCTCAA
TACCGGGATGCGGAGGAGGCCTTTTCCGAAGAATTCACGCACATGAGATACACGGCCGCCACCTGTGATCCCGAC
GAGTTCACGCTGCGCAATGGCTACAATCTCCGGCCGGCTATCTACAACCGGCATACCGAATTGCTGATCGCCATC
ACCTACTACAACGAAGACAAGGTGTTGACCGCGCGTACCCTTCACGGTGTCATGCAGAACATCCGTGATATTGTC
AACTTGAAGAAATCCGAGTTCTGGAACAAGGGTGGCCCTGCTTGGCAGAAGATCGTGGTCTGTTTGGTTTTCGAT
GGTATTGAGCCATGCGACAAAAACACACTGGATGTGTTGGCGACGATTGGTATCTACCAGGATGGAGTCATGAAG
AAGGACGTTGACGGGCGGGAAACCGTCGCCCACGTTTTTGAATATACTACCCAATTGTCCGTCACTCCGACGCAG
CAGTTGATCCGGCCCCAGGGCAATGAGTCGACCAACTTGCCCCCCGTGCAGATGATCTTCTGTCTCAAGCAGAAG
AATAGCAAGAAGATCAACTCCCACCGTTGGCTGTTCAACGCCTTCAGTCGTATCTTGAACCCGGAAGTCGTCATT
CTGCTGGATGCCGGTACTAAGCCCGGACACAAATCTCTGCTTGCTCTGTGGGAGGCCTTCTACAATGACAAGACT
CTCGGTGGAGCCTGTGGTGAGATCCATGCAATGCTGGGTCAGGGCTGGCGCAAGGTCATCAATCCGTTAGTCGCT
GCGCAGAACTTTGAGTACAAGATCTCCAATATTCTCGATAAACCTCTGGAAAGTGCATTCGGTTATGTCAGTGTC
TTGCCTGGTGCATTCTCTGCCTATCGGTATCGCGCTATCATGGGCCGTCCCCTGGAGCAATACTTCCACGGAGAC
CATACGTTATCTAAGCGTCTTGGAAAGAAGGGTATTGACGGCATGAATATCTTCAAAAAGAACATGTTCTTGGCT
GAGGATCGTATTCTTTGCTTCGAATTGGTGGCCAAGGCTGGTTTCAAGTGGCATCTCAGTTACGTCAAGGCGTCC
AAGGGTGAGACCGATGTTCCGGAAGGTGCAGCCGAATTCATCAGTCAAAGACGTCGTTGGTTGAACGGTTCTTTC
GCTGCCGGTCTGTATGCCATCATGCATTTCGGCCGTATCTACCGCAGTGGTCACAGCATCATTCGCATGTTCTTC
CTGCATATTCAGATGCTCTACAACGTGTGTCAACTGATCATGACCTGGTTCTCACTTGCCTCTTACTGGCTCACT
AGTTCCGTCATCATGGATTTGGTGGGTACGCCGTCTACGAGTAACAAGAACAAGGGTTGGCCATGGGGCAACGAA
GCGTCGCCCATTGTCAACAACTTCGTCAAATACGGTTATGTCTGGGTTCTTACGCTGCAGTTTATCATGGCTTTG
GGTAATCGGCCGAAAGGTGTCAAGATCCCTTACATCCTATCCTACCTTTACTTCTCTCTTGTCCAGCTGTACGTC
CTCATCCTGTCGTTCTACCTGGTCGTGGGTGCCTTCAACGGTGGTATGATGGACTTCAACTTCGACGAAGGCGTC
GGCACATTCCTCTCCTCATTCTTCAGCTCCAGCGGTGGTGGTATCGTGCTGATCGCTTTGGTCTCCACTTACGGA
ATCTACATCATTGCTAGTGTCCTGTATATGGATCCCTGGCACATCATCACCAGTTCCTGGGCCTACTTCCTGGGT
ATGACGACCTCGATCAACATCTTGATGGTTTACGCGTTCTGTAACTGGCACGACGTTTCTTGGGGTACCAAGGGT
TCGGACAAGGCCGAGGCACTGCCTTCCGCGCAAACCAAAAAGGACGACGACAACAAGCAGAACTTCATCGAGGAA
ATCGACAAGCCGCAAGCCGATATCGACAGTCAGTTCGAGGCGACTGTGAAGAGAGCGTTGACGCCGTGGATCGAA
CCGGAGGAAGAGGGCGGCAAGAGTTTGGACGATGCCTACCGCAACTTCCGTACCGTGCTTGTGTGTCTGTGGGTG
TTTAGTAACTTGCTCGTAACGCTGTTGATCACCGCCACTGGAGTGGACAAGATGTGTCTGACGAACACCTCCACC
ACCCGTACATCCTGGTACTTCGAAGTCATTCTGTGGATTACGGCCGGTCTGTCGCTGTTCCGCTTCATCGGCTCG
TTGTGGTTCTTGGGCCGGTCGGGTATTCTGTGCTGTGTGTCCCGGCGCTAA
Gene >Ani_SJS72_1|g7873.t1
ATGGGTACGCCAACACCTTACTCGGCCCATTCGCCGCGGGACAGCGAAAGCAGCTACTTCTCCCACACGTCTCCC
CCCCATGGTGTGAGTGTGTCCCGTCAAGCTGGCCGGCTGTTTCAATACCTAATCGTGATAGCACCAAACTTACCA
CTCCGAGGAACATGAGCACGACGAGCAGGAACAGTCTCTGCTGGAGCGCAACAATTCCAGTCACTATGGCACGCC
CTTCGATGATCCCGCCGTGTCGACAGACTCCCTCCGTCGCTACACTCTGCACGACGACGGTCCAGCGGTCTTCGC
CGCGCCTCCTTACCAAGAATCCGAAGCCGCTTCCGAAAACACCTTCCGTGCCCGGAGCAATGGCGACAAGGCTTC
CCGTGAAGGGAGTCGCGCGGGTGCCCTGCGCCGTTACGGAACGAGAAAGATCAACCTAGTGCAAGGTTCCGTTCT
GAGTGTCGACTACCCGGTGCCGAGTGCCATTCAGAACGCCATCCAGCCTCAATACCGGGATGCGGAGGAGGCCTT
TTCCGAAGAATTCACGCACATGAGATGTAGGTGCCACACGCGCCTTCGCGGAGATGGCCAATTGTCCGGCTGACC
AAAGCATCGCAGACACGGCCGCCACCTGTGATCCCGACGAGTTCACGCTGCGCAATGGCTACAATCTCCGGCCGG
CTATCTACAACCGGCATACCGAATTGCTGATCGCCATCACCTACTACAACGAAGACAAGGTGTTGACCGCGCGTA
CCCTTCACGGTGTCATGCAGAACATCCGTGATATTGTCAACTTGAAGAAATCCGAGTTCTGGAACAAGGGTGGCC
CTGCTTGGCAGAAGATCGTGGTCTGTTTGGTTTTCGATGGTATTGAGCCATGCGACAAAAACACACTGGATGTGT
TGGCGACGATTGGTATCTACCAGGATGGAGTCATGAAGAAGGACGTTGACGGGCGGGAAACCGTCGCCCACGTTG
TAAGTTTGCTTCTTTCCACTTTTTCTTCCGCTGCCGCCTTTGGTGCAGACCGCCTTCGGACCATCGGAGATCGGC
ACCGCAAAGGAGGAGGATGAATGAGAGACACTGACCGCCGCAGTTTGAATATACTACCCAATTGTCCGTCACTCC
GACGCAGCAGTTGATCCGGCCCCAGGGCAATGAGTCGACCAACTTGCCCCCCGTGCAGATGATCTTCTGTCTCAA
GCAGAAGAATAGCAAGAAGATCAACTCCCACCGTTGGCTGTTCAACGCCTTCAGTCGTATCTTGAACCCGGAAGT
CGTCATTCTGCTGGATGCCGGTACTAAGCCCGGACACAAATCTCTGCTTGCTCTGTGGGAGGCCTTCTACAATGA
CAAGACTCTCGGTGGAGCCTGTGGTGAGATCCATGCAATGCTGGGTCAGGGCTGGCGCAAGGTCATCAATCCGTT
AGTCGCTGCGCAGAACTTTGAGTACAAGATCTCCAATATTCTCGATAAACCTCTGGAAAGTGCATTCGGTTATGT
CAGTGTCTTGCCTGGTGCATTCTCTGCCTATCGGTATCGCGCTATCATGGGCCGTCCCCTGGAGCAATACTTCCA
CGGAGACCATACGTTATCTAAGCGTCTTGGAAAGAAGGGTATTGACGGCATGAATATCTTCAAAAAGAACATGTT
CTTGGCTGAGGATCGTATTCTTTGCTTCGAATTGGTGGCCAAGGCTGGTTTCAAGTGGCATCTCAGTTACGTCAA
GGCGTCCAAGGGTGAGACCGATGTTCCGGAAGGTGCAGCCGAATTCATCAGTCAAAGACGTCGTTGGTTGAACGG
TTCTTTCGCTGCCGGTCTGTATGCCATCATGCATTTCGGCCGTATCTACCGCAGTGGTCACAGCATCATTCGCAT
GTTCTTCCTGCATATTCAGATGCTCTACAACGTGTGTCAACTGATCATGACCTGGTTCTCACTTGCCTCTTACTG
GCTCACTAGTTCCGTCATCATGGATTTGGTGGGTACGCCGTCTACGAGTAACAAGAACAAGGGTTGGCCATGGGG
CAACGAAGCGTCGCCCATTGTCAACAACTTCGTCAAATACGGTTATGTCTGGGTTCTTACGCTGCAGTTTATCAT
GGCTTTGGGTAATCGGCCGAAAGGTGTCAAGATCCCTTACATCCTATCCTACCTTTACTTCTCTCTTGTCCAGCT
GTACGTCCTCATCCTGTCGTTCTACCTGGTCGTGGGTGCCTTCAACGGTGGTATGATGGACTTCAACTTCGACGA
AGGCGTCGGCACATTCCTCTCCTCATTCTTCAGCTCCAGCGGTGGTGGTATCGTGCTGATCGCTTTGGTCTCCAC
TTACGGAATCTACATCATTGCTAGTGTCCTGTATATGGATCCCTGGCACATCATCACCAGTTCCTGGGCCTACTT
CCTGGGTATGACGACCTCGATCAACATCTTGATGGTTTACGCGTTCTGTAACTGGCACGACGTTTCTTGGGGTAC
CAAGGGTTCGGACAAGGCCGAGGCACTGCCTTCCGCGCAAACCAAAAAGGACGACGACAACAAGCAGAACTTCAT
CGAGGAAATCGACAAGCCGCAAGCCGATATCGACAGTCAGTTCGAGGCGACTGTGAAGAGAGCGTTGACGCCGTG
GATCGAACCGGAGGAAGAGGGCGGCAAGAGTTTGGACGATGCCTACCGCAACTTCCGTACCGTGCTTGTGTGTCT
GTGGGTGTTTAGTAACTTGCTCGTAACGCTGTTGATCACCGCCACTGGAGTGGACAAGATGTGTCTGACGGTACG
TATCATCCCTTTGCTTTGGTAAAGCCATAATCTGTGACATCTTCTAACGAACTGCAGAACACCTCCACCACCCGT
ACATCCTGGTACTTCGAAGTCATTCTGTGGATTACGGCCGGTCTGTCGCTGTTCCGCTTCATCGGCTCGTTGTGG
TTCTTGGGCCGGTCGGGTATTCTGTGCTGTGTGTCCCGGCGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail