Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g7552.t1
Gene name
Locationscaffold_062:108675..110061
Strand-
Gene length (bp)1386
Transcript length (bp)1386
Coding sequence length (bp)1386
Protein length (aa) 462

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01593 Amino_oxidase Flavin containing amine oxidoreductase 4.7E-13 47 287
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 6.1E-09 37 91
PF12831 FAD_oxidored FAD dependent oxidoreductase 6.1E-08 34 90

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g7552.t1
MVHFISLFYTLVGLLPAAALPSSTHHSLETITCDICILGGGSSGTYSAIQLKDAGKHVVVIEPNNRLGGHAATLY
LPDGNYVDYGVEGVFNNELSRNYFLRLGVYWKPLLPLNKRTDFVDFSTGERVNPAAGILQALVSTFLYRSSIKHW
TFLTRGVYDLPDPVPEELLRPFREFIEEHSLEAALQLVFLFSQNVGNLLDMPTLYAIQNFGVPHVDALIHGYITP
KNGMYELYRQAREILGSDVLFHTNVIATNRSDSGVEVTVQHANGTCQLIKARNLLITFPPLIKKLQGFDLDETET
ELFQKWFWRTYYVAVVNNTGIPDKLWVTNTDPTNGLGYLPRMPFDFLLQYMGAPGHSTSKLVGDMDFTEEDARDL
LAADFARMKAKGTYPIQDPQIVVFGDSSPETLMVSPEEIRNGFYRKLYALQGRRSTYFTGLTFCSDFSSLIWAYT
ETVLESMNWDV*
Coding >Ani_SJS72_1|g7552.t1
ATGGTCCACTTTATAAGCCTATTCTATACCCTCGTAGGCTTACTACCAGCGGCTGCCCTTCCCTCATCAACCCAC
CACTCTCTCGAGACAATAACCTGCGACATTTGCATCCTCGGAGGTGGAAGCTCAGGGACGTACAGCGCCATCCAA
CTCAAAGATGCAGGGAAGCACGTGGTAGTAATAGAGCCCAACAACAGGCTAGGAGGGCACGCAGCGACATTATAC
CTGCCAGATGGCAACTACGTCGACTACGGCGTCGAAGGCGTCTTCAACAACGAGCTCTCCCGCAACTATTTCCTC
CGACTCGGAGTATACTGGAAGCCACTACTCCCACTGAACAAACGAACCGACTTTGTCGACTTCTCGACAGGTGAA
CGCGTGAACCCCGCAGCAGGAATCTTGCAAGCCCTCGTATCAACATTTCTTTACCGCTCATCCATAAAGCACTGG
ACGTTTCTCACAAGAGGGGTTTACGACCTCCCCGACCCAGTACCAGAAGAACTTCTCCGCCCATTCCGTGAATTC
ATCGAGGAACATTCCCTCGAAGCTGCTCTGCAGTTGGTATTTCTCTTTTCTCAGAATGTAGGAAATCTGCTCGAT
ATGCCCACCCTCTATGCGATCCAGAATTTCGGGGTCCCGCACGTTGACGCTCTCATTCATGGATACATCACACCG
AAAAACGGCATGTACGAGCTTTACAGACAAGCGAGGGAAATACTCGGCTCGGATGTGCTGTTCCACACAAACGTG
ATCGCAACAAATAGGTCCGATTCCGGCGTGGAGGTAACAGTTCAGCATGCGAACGGTACTTGTCAGCTCATTAAA
GCCAGAAACCTCCTCATTACCTTCCCTCCGCTCATAAAAAAGCTCCAAGGCTTCGATTTGGATGAAACAGAAACG
GAACTATTCCAGAAATGGTTCTGGAGGACATACTACGTCGCCGTGGTTAATAATACCGGTATCCCGGACAAGCTG
TGGGTCACCAATACAGACCCGACTAATGGACTGGGGTATTTACCTCGAATGCCATTTGATTTCCTGCTGCAGTAT
ATGGGAGCACCAGGGCATTCAACTAGCAAGTTAGTAGGCGATATGGACTTCACCGAGGAAGATGCGAGAGACCTT
CTAGCGGCGGATTTTGCGCGGATGAAGGCAAAGGGGACGTACCCGATTCAGGATCCTCAAATTGTGGTATTTGGG
GATAGTTCGCCGGAGACGCTGATGGTGTCGCCGGAGGAGATTCGTAACGGATTTTATCGCAAGTTGTATGCGTTG
CAGGGGAGGAGGAGTACGTATTTTACTGGGTTGACGTTTTGTTCGGATTTTTCGTCGTTGATTTGGGCGTATACC
GAGACGGTTTTGGAGAGTATGAATTGGGATGTGTAG
Transcript >Ani_SJS72_1|g7552.t1
ATGGTCCACTTTATAAGCCTATTCTATACCCTCGTAGGCTTACTACCAGCGGCTGCCCTTCCCTCATCAACCCAC
CACTCTCTCGAGACAATAACCTGCGACATTTGCATCCTCGGAGGTGGAAGCTCAGGGACGTACAGCGCCATCCAA
CTCAAAGATGCAGGGAAGCACGTGGTAGTAATAGAGCCCAACAACAGGCTAGGAGGGCACGCAGCGACATTATAC
CTGCCAGATGGCAACTACGTCGACTACGGCGTCGAAGGCGTCTTCAACAACGAGCTCTCCCGCAACTATTTCCTC
CGACTCGGAGTATACTGGAAGCCACTACTCCCACTGAACAAACGAACCGACTTTGTCGACTTCTCGACAGGTGAA
CGCGTGAACCCCGCAGCAGGAATCTTGCAAGCCCTCGTATCAACATTTCTTTACCGCTCATCCATAAAGCACTGG
ACGTTTCTCACAAGAGGGGTTTACGACCTCCCCGACCCAGTACCAGAAGAACTTCTCCGCCCATTCCGTGAATTC
ATCGAGGAACATTCCCTCGAAGCTGCTCTGCAGTTGGTATTTCTCTTTTCTCAGAATGTAGGAAATCTGCTCGAT
ATGCCCACCCTCTATGCGATCCAGAATTTCGGGGTCCCGCACGTTGACGCTCTCATTCATGGATACATCACACCG
AAAAACGGCATGTACGAGCTTTACAGACAAGCGAGGGAAATACTCGGCTCGGATGTGCTGTTCCACACAAACGTG
ATCGCAACAAATAGGTCCGATTCCGGCGTGGAGGTAACAGTTCAGCATGCGAACGGTACTTGTCAGCTCATTAAA
GCCAGAAACCTCCTCATTACCTTCCCTCCGCTCATAAAAAAGCTCCAAGGCTTCGATTTGGATGAAACAGAAACG
GAACTATTCCAGAAATGGTTCTGGAGGACATACTACGTCGCCGTGGTTAATAATACCGGTATCCCGGACAAGCTG
TGGGTCACCAATACAGACCCGACTAATGGACTGGGGTATTTACCTCGAATGCCATTTGATTTCCTGCTGCAGTAT
ATGGGAGCACCAGGGCATTCAACTAGCAAGTTAGTAGGCGATATGGACTTCACCGAGGAAGATGCGAGAGACCTT
CTAGCGGCGGATTTTGCGCGGATGAAGGCAAAGGGGACGTACCCGATTCAGGATCCTCAAATTGTGGTATTTGGG
GATAGTTCGCCGGAGACGCTGATGGTGTCGCCGGAGGAGATTCGTAACGGATTTTATCGCAAGTTGTATGCGTTG
CAGGGGAGGAGGAGTACGTATTTTACTGGGTTGACGTTTTGTTCGGATTTTTCGTCGTTGATTTGGGCGTATACC
GAGACGGTTTTGGAGAGTATGAATTGGGATGTGTAG
Gene >Ani_SJS72_1|g7552.t1
ATGGTCCACTTTATAAGCCTATTCTATACCCTCGTAGGCTTACTACCAGCGGCTGCCCTTCCCTCATCAACCCAC
CACTCTCTCGAGACAATAACCTGCGACATTTGCATCCTCGGAGGTGGAAGCTCAGGGACGTACAGCGCCATCCAA
CTCAAAGATGCAGGGAAGCACGTGGTAGTAATAGAGCCCAACAACAGGCTAGGAGGGCACGCAGCGACATTATAC
CTGCCAGATGGCAACTACGTCGACTACGGCGTCGAAGGCGTCTTCAACAACGAGCTCTCCCGCAACTATTTCCTC
CGACTCGGAGTATACTGGAAGCCACTACTCCCACTGAACAAACGAACCGACTTTGTCGACTTCTCGACAGGTGAA
CGCGTGAACCCCGCAGCAGGAATCTTGCAAGCCCTCGTATCAACATTTCTTTACCGCTCATCCATAAAGCACTGG
ACGTTTCTCACAAGAGGGGTTTACGACCTCCCCGACCCAGTACCAGAAGAACTTCTCCGCCCATTCCGTGAATTC
ATCGAGGAACATTCCCTCGAAGCTGCTCTGCAGTTGGTATTTCTCTTTTCTCAGAATGTAGGAAATCTGCTCGAT
ATGCCCACCCTCTATGCGATCCAGAATTTCGGGGTCCCGCACGTTGACGCTCTCATTCATGGATACATCACACCG
AAAAACGGCATGTACGAGCTTTACAGACAAGCGAGGGAAATACTCGGCTCGGATGTGCTGTTCCACACAAACGTG
ATCGCAACAAATAGGTCCGATTCCGGCGTGGAGGTAACAGTTCAGCATGCGAACGGTACTTGTCAGCTCATTAAA
GCCAGAAACCTCCTCATTACCTTCCCTCCGCTCATAAAAAAGCTCCAAGGCTTCGATTTGGATGAAACAGAAACG
GAACTATTCCAGAAATGGTTCTGGAGGACATACTACGTCGCCGTGGTTAATAATACCGGTATCCCGGACAAGCTG
TGGGTCACCAATACAGACCCGACTAATGGACTGGGGTATTTACCTCGAATGCCATTTGATTTCCTGCTGCAGTAT
ATGGGAGCACCAGGGCATTCAACTAGCAAGTTAGTAGGCGATATGGACTTCACCGAGGAAGATGCGAGAGACCTT
CTAGCGGCGGATTTTGCGCGGATGAAGGCAAAGGGGACGTACCCGATTCAGGATCCTCAAATTGTGGTATTTGGG
GATAGTTCGCCGGAGACGCTGATGGTGTCGCCGGAGGAGATTCGTAACGGATTTTATCGCAAGTTGTATGCGTTG
CAGGGGAGGAGGAGTACGTATTTTACTGGGTTGACGTTTTGTTCGGATTTTTCGTCGTTGATTTGGGCGTATACC
GAGACGGTTTTGGAGAGTATGAATTGGGATGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail