Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g7131.t1
Gene name
Locationscaffold_056:205367..206476
Strand-
Gene length (bp)1109
Transcript length (bp)1023
Coding sequence length (bp)1023
Protein length (aa) 341

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07950 MCP1_TM MDM10-complementing protein 1, transmembrane domain 2.5E-05 93 169
PF07950 MCP1_TM MDM10-complementing protein 1, transmembrane domain 2.9E-33 190 316

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.45

Transmembrane Domains

Domain # Start End Length
1 229 251 22
2 290 312 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g7131.t1
MAASKESMPSKPEDIETRSIFSMQELDPSPVQDEFPDLESGDYFPREPSPPSAREPIAGGGRFSSLKLGLRGHSW
DSWLSAFQRYSTYPPTLFFALHWANTSLIPLATRSVPDSESFLLLTRPVYQSPGLEHLVLTAPVLIHIASGIALR
NIRSARRARLYGAETRSQRHSLTFWPRMSLQARLGYSLVPLLGVHVLVNRITPLMVDGGSSGVGLGYVAHGFARA
PALWNLYYLLFVAVGVWHFVGGWAAWMGWRVTTVRKERDRKKGSLEGYLGASESEQRLRRQRKMWWTVNGIAAVG
ASIWLAGALGIIGRTGQGYGWEAKGWNEIYSQVPVIGSWL*
Coding >Ani_SJS72_1|g7131.t1
ATGGCTGCCTCGAAAGAAAGCATGCCATCCAAACCAGAGGATATCGAAACGCGCTCCATATTTTCAATGCAAGAG
TTAGACCCATCACCAGTACAAGATGAGTTTCCAGACCTTGAATCTGGTGACTACTTCCCCAGAGAACCAAGTCCG
CCATCGGCACGCGAGCCCATCGCCGGGGGTGGTCGGTTCTCGTCGCTCAAGTTAGGCCTTCGCGGACATAGTTGG
GATTCCTGGTTATCTGCGTTCCAACGATACTCGACGTATCCACCGACCCTATTCTTTGCATTGCATTGGGCCAAT
ACCTCTCTCATCCCTCTGGCTACTCGATCTGTGCCCGACAGCGAGAGCTTCCTGCTTCTCACCAGACCCGTCTAT
CAATCTCCGGGCCTCGAACATCTCGTTCTGACCGCGCCTGTTCTGATTCATATTGCGTCTGGAATTGCTTTGCGC
AACATCCGCTCCGCACGGCGGGCTCGACTCTATGGCGCCGAGACAAGGTCACAGAGACACTCCTTGACGTTTTGG
CCTCGGATGAGCCTCCAAGCTCGGTTAGGATATTCCTTAGTTCCGTTACTCGGCGTCCATGTGCTCGTCAACCGC
ATCACTCCGTTGATGGTTGATGGGGGAAGCTCGGGAGTCGGGCTGGGTTATGTGGCCCACGGCTTTGCACGGGCC
CCCGCACTCTGGAATCTGTACTATTTGTTATTCGTCGCCGTTGGGGTGTGGCACTTCGTCGGCGGCTGGGCTGCA
TGGATGGGCTGGAGAGTGACAACGGTCCGGAAGGAACGTGACCGAAAGAAAGGCTCCCTAGAGGGTTATCTGGGA
GCCTCGGAAAGTGAGCAACGACTCCGCCGACAGAGGAAGATGTGGTGGACGGTCAACGGCATTGCCGCGGTGGGA
GCATCCATATGGCTTGCAGGTGCCCTGGGAATCATCGGGCGTACGGGGCAGGGTTATGGCTGGGAGGCCAAGGGA
TGGAATGAGATCTACAGCCAGGTCCCCGTTATTGGGTCCTGGCTCTGA
Transcript >Ani_SJS72_1|g7131.t1
ATGGCTGCCTCGAAAGAAAGCATGCCATCCAAACCAGAGGATATCGAAACGCGCTCCATATTTTCAATGCAAGAG
TTAGACCCATCACCAGTACAAGATGAGTTTCCAGACCTTGAATCTGGTGACTACTTCCCCAGAGAACCAAGTCCG
CCATCGGCACGCGAGCCCATCGCCGGGGGTGGTCGGTTCTCGTCGCTCAAGTTAGGCCTTCGCGGACATAGTTGG
GATTCCTGGTTATCTGCGTTCCAACGATACTCGACGTATCCACCGACCCTATTCTTTGCATTGCATTGGGCCAAT
ACCTCTCTCATCCCTCTGGCTACTCGATCTGTGCCCGACAGCGAGAGCTTCCTGCTTCTCACCAGACCCGTCTAT
CAATCTCCGGGCCTCGAACATCTCGTTCTGACCGCGCCTGTTCTGATTCATATTGCGTCTGGAATTGCTTTGCGC
AACATCCGCTCCGCACGGCGGGCTCGACTCTATGGCGCCGAGACAAGGTCACAGAGACACTCCTTGACGTTTTGG
CCTCGGATGAGCCTCCAAGCTCGGTTAGGATATTCCTTAGTTCCGTTACTCGGCGTCCATGTGCTCGTCAACCGC
ATCACTCCGTTGATGGTTGATGGGGGAAGCTCGGGAGTCGGGCTGGGTTATGTGGCCCACGGCTTTGCACGGGCC
CCCGCACTCTGGAATCTGTACTATTTGTTATTCGTCGCCGTTGGGGTGTGGCACTTCGTCGGCGGCTGGGCTGCA
TGGATGGGCTGGAGAGTGACAACGGTCCGGAAGGAACGTGACCGAAAGAAAGGCTCCCTAGAGGGTTATCTGGGA
GCCTCGGAAAGTGAGCAACGACTCCGCCGACAGAGGAAGATGTGGTGGACGGTCAACGGCATTGCCGCGGTGGGA
GCATCCATATGGCTTGCAGGTGCCCTGGGAATCATCGGGCGTACGGGGCAGGGTTATGGCTGGGAGGCCAAGGGA
TGGAATGAGATCTACAGCCAGGTCCCCGTTATTGGGTCCTGGCTCTGA
Gene >Ani_SJS72_1|g7131.t1
ATGGCTGCCTCGAAAGAAAGCATGCCATCCAAACCAGAGGATATCGAAACGCGCTCCATATTTTCAATGCAAGAG
TTAGACCCATCACCAGTACAAGATGAGTTTCCAGACCTTGAATCTGGTGACTACTTCCCCAGAGAACCAAGTCCG
CCATCGGCACGCGAGCCCATCGCCGGGGGTGGTCGGTTCTCGTCGCTCAAGTTAGGCCTTCGCGGACATAGTTGG
GATTCCTGGTGTATGGCTAAGTATATGCAAGCTATTGTGATAATAGCAAGAATTTACTCTTTTCCTAGAAGCTAA
CAGTGGCCTCAAATTCTCCAGTATCTGCGTTCCAACGATACTCGACGTATCCACCGACCCTATTCTTTGCATTGC
ATTGGGCCAATACCTCTCTCATCCCTCTGGCTACTCGATCTGTGCCCGACAGCGAGAGCTTCCTGCTTCTCACCA
GACCCGTCTATCAATCTCCGGGCCTCGAACATCTCGTTCTGACCGCGCCTGTTCTGATTCATATTGCGTCTGGAA
TTGCTTTGCGCAACATCCGCTCCGCACGGCGGGCTCGACTCTATGGCGCCGAGACAAGGTCACAGAGACACTCCT
TGACGTTTTGGCCTCGGATGAGCCTCCAAGCTCGGTTAGGATATTCCTTAGTTCCGTTACTCGGCGTCCATGTGC
TCGTCAACCGCATCACTCCGTTGATGGTTGATGGGGGAAGCTCGGGAGTCGGGCTGGGTTATGTGGCCCACGGCT
TTGCACGGGCCCCCGCACTCTGGAATCTGTACTATTTGTTATTCGTCGCCGTTGGGGTGTGGCACTTCGTCGGCG
GCTGGGCTGCATGGATGGGCTGGAGAGTGACAACGGTCCGGAAGGAACGTGACCGAAAGAAAGGCTCCCTAGAGG
GTTATCTGGGAGCCTCGGAAAGTGAGCAACGACTCCGCCGACAGAGGAAGATGTGGTGGACGGTCAACGGCATTG
CCGCGGTGGGAGCATCCATATGGCTTGCAGGTGCCCTGGGAATCATCGGGCGTACGGGGCAGGGTTATGGCTGGG
AGGCCAAGGGATGGAATGAGATCTACAGCCAGGTCCCCGTTATTGGGTCCTGGCTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail