Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g6684.t1
Gene name
Locationscaffold_051:66094..68494
Strand-
Gene length (bp)2400
Transcript length (bp)2307
Coding sequence length (bp)2307
Protein length (aa) 769

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08733 PalH PalH/RIM21 8.1E-111 28 385

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 86 108 22
2 227 246 19
3 268 290 22
4 303 325 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g6684.t1
MGEPAHLTPRQIWAQPTTTTTRTYEADCTPFLLPSSGYVYLNRSYSIALTENAIYDPICTGTGTATATAHAVAAL
DVTDPFYSSVTPALYAMGCTTVVSYLLVIILLITPRTFYVGGPGGGANFLGRHGMISGSYSGNSSVVGVGGRPWL
QKVAALLVAVSLTIATVDSFRVAEQQYYYGYSDAEALADEVIDGMEIRVVRIISSTFLWLAQIQTLIRLFPRHKE
KIMIKWAGFALIVFDTTFSILDKFLVKTDTVHPRLYEDAIPALSYLFELALNLLYAAWVIFYSLSKHRFAFFHPK
MRNICLVALLSLCAILIPVVFFVLDIAKPKIAGWGTYVRWVGSAAASVVVWEWVERIEALERDERKDGILGREIF
DGDEMLEVTPSEEVDWPRYNPDGHDRGGGGGTSSGWGGMMGLAHRPLRTRVGRNWQSNLENQQHNIPMDPRRRRM
APRPTPPPAAITPVSRADTTSAASTVYNIHYHPVSSPTPPVAMPHMEEEDEDIDETVAAKEMTTEGQQAGLAHDV
LAQQQTREQSPQIVHVDKRWRALLNPFKRRRASLPREVASAQAEEEGNPAGAQVELQRHSLDDSDDEHSLQHRHD
FRFGFHRRLRPGSGRQGSDSPLPVTVIPARRRGQQTWSPQQYHEPSSRTTTSNQRVPPGRDDLPVRVIQPQTRTA
APWSAADGQGFSHGNYELRYDPEAAALVEPGENCTESQPALDADGSVSEPTRGPAGRQQPEQEFDPMEGAPLSPA
QPFPDEVPEDSRGSHGQQ*
Coding >Ani_SJS72_1|g6684.t1
ATGGGGGAACCCGCTCATCTAACGCCTCGCCAAATTTGGGCTCAACCGACGACAACGACCACCAGGACCTATGAA
GCTGACTGCACGCCGTTTCTATTACCCAGCTCTGGTTACGTCTATTTGAATCGCTCCTACTCCATCGCCTTGACC
GAAAATGCCATCTACGATCCCATCTGTACGGGCACGGGCACAGCGACTGCCACGGCTCATGCGGTCGCCGCGCTC
GATGTCACCGACCCTTTTTATTCCTCCGTGACCCCGGCGTTGTATGCCATGGGCTGTACGACCGTTGTCAGCTAT
CTTCTCGTTATTATTCTTCTCATCACGCCGCGTACGTTTTATGTTGGAGGTCCTGGTGGGGGTGCGAACTTTCTC
GGACGTCATGGTATGATTAGCGGTTCGTATAGTGGTAATTCGTCGGTGGTCGGCGTTGGTGGTCGCCCGTGGTTG
CAGAAGGTCGCAGCCTTGTTAGTCGCGGTATCGCTCACCATCGCGACTGTGGACTCCTTCCGTGTGGCTGAACAG
CAATACTATTATGGTTACTCCGATGCCGAAGCGCTGGCCGACGAGGTCATCGACGGTATGGAGATCCGGGTGGTC
AGAATCATTTCCAGCACCTTTTTGTGGCTGGCCCAGATTCAGACTTTGATTCGGCTATTCCCTCGACATAAGGAG
AAAATAATGATCAAATGGGCAGGGTTCGCGTTAATCGTGTTCGATACGACATTTAGTATCCTCGACAAGTTCTTG
GTCAAAACCGATACCGTTCACCCACGGCTCTATGAAGACGCGATTCCCGCTCTCAGCTATCTGTTCGAACTTGCA
CTCAACCTATTGTACGCCGCTTGGGTCATCTTCTATTCGCTTTCGAAACATCGCTTCGCCTTCTTCCATCCGAAA
ATGAGGAACATCTGCTTGGTGGCCTTGCTATCGTTATGTGCGATCCTTATACCCGTTGTGTTTTTTGTCCTGGAT
ATCGCAAAACCGAAAATCGCCGGATGGGGTACTTATGTCAGGTGGGTTGGTTCGGCTGCAGCAAGTGTCGTGGTT
TGGGAATGGGTGGAGCGGATCGAAGCATTGGAACGCGATGAGAGGAAGGATGGGATTCTTGGACGCGAAATATTT
GATGGAGATGAGATGTTGGAAGTGACCCCTTCGGAAGAAGTCGATTGGCCGCGCTACAATCCTGACGGCCATGAT
CGAGGCGGAGGCGGTGGAACGTCTTCAGGATGGGGAGGCATGATGGGACTGGCTCATCGTCCTTTACGTACGAGG
GTGGGTCGCAATTGGCAGTCGAACCTGGAGAACCAGCAACACAACATTCCCATGGACCCTCGGCGCCGGCGCATG
GCACCCCGACCAACTCCTCCCCCAGCAGCTATAACGCCTGTTAGTCGGGCCGACACAACCAGCGCGGCCAGTACG
GTATACAACATACATTATCATCCGGTGTCTAGTCCAACTCCACCGGTGGCCATGCCTCATATGGAGGAAGAGGAC
GAAGACATAGACGAAACGGTGGCTGCGAAGGAGATGACAACCGAAGGTCAGCAAGCTGGCCTAGCTCATGATGTG
CTGGCACAACAACAGACCCGGGAACAATCCCCTCAGATTGTGCACGTGGATAAAAGATGGCGAGCGCTGCTGAAT
CCTTTCAAACGAAGGCGTGCATCTTTGCCAAGAGAAGTCGCGTCTGCACAGGCCGAGGAAGAAGGGAATCCCGCA
GGTGCTCAAGTGGAACTGCAACGCCATTCTCTGGATGATAGCGACGATGAGCACAGCTTACAGCACAGGCACGAT
TTTCGGTTTGGCTTCCATCGAAGATTGCGACCCGGTTCTGGACGACAAGGCTCCGACTCGCCCTTGCCAGTCACG
GTCATTCCTGCTAGACGCCGTGGTCAACAGACCTGGTCGCCGCAGCAATATCATGAGCCTAGTTCACGAACAACA
ACTTCGAATCAGCGTGTTCCGCCTGGCCGTGATGACCTGCCTGTAAGGGTGATTCAGCCGCAAACGCGAACTGCT
GCTCCATGGAGCGCAGCCGATGGGCAAGGGTTCAGTCATGGCAACTATGAGCTGCGCTATGACCCTGAAGCTGCG
GCACTTGTGGAACCTGGTGAGAATTGCACTGAATCTCAGCCGGCGCTGGACGCCGATGGCTCGGTCAGCGAGCCT
ACTCGGGGGCCGGCTGGGCGCCAACAACCCGAGCAGGAATTCGACCCGATGGAAGGAGCACCTCTATCACCGGCT
CAACCTTTTCCTGACGAGGTCCCCGAAGATTCACGAGGGTCACATGGCCAGCAGTGA
Transcript >Ani_SJS72_1|g6684.t1
ATGGGGGAACCCGCTCATCTAACGCCTCGCCAAATTTGGGCTCAACCGACGACAACGACCACCAGGACCTATGAA
GCTGACTGCACGCCGTTTCTATTACCCAGCTCTGGTTACGTCTATTTGAATCGCTCCTACTCCATCGCCTTGACC
GAAAATGCCATCTACGATCCCATCTGTACGGGCACGGGCACAGCGACTGCCACGGCTCATGCGGTCGCCGCGCTC
GATGTCACCGACCCTTTTTATTCCTCCGTGACCCCGGCGTTGTATGCCATGGGCTGTACGACCGTTGTCAGCTAT
CTTCTCGTTATTATTCTTCTCATCACGCCGCGTACGTTTTATGTTGGAGGTCCTGGTGGGGGTGCGAACTTTCTC
GGACGTCATGGTATGATTAGCGGTTCGTATAGTGGTAATTCGTCGGTGGTCGGCGTTGGTGGTCGCCCGTGGTTG
CAGAAGGTCGCAGCCTTGTTAGTCGCGGTATCGCTCACCATCGCGACTGTGGACTCCTTCCGTGTGGCTGAACAG
CAATACTATTATGGTTACTCCGATGCCGAAGCGCTGGCCGACGAGGTCATCGACGGTATGGAGATCCGGGTGGTC
AGAATCATTTCCAGCACCTTTTTGTGGCTGGCCCAGATTCAGACTTTGATTCGGCTATTCCCTCGACATAAGGAG
AAAATAATGATCAAATGGGCAGGGTTCGCGTTAATCGTGTTCGATACGACATTTAGTATCCTCGACAAGTTCTTG
GTCAAAACCGATACCGTTCACCCACGGCTCTATGAAGACGCGATTCCCGCTCTCAGCTATCTGTTCGAACTTGCA
CTCAACCTATTGTACGCCGCTTGGGTCATCTTCTATTCGCTTTCGAAACATCGCTTCGCCTTCTTCCATCCGAAA
ATGAGGAACATCTGCTTGGTGGCCTTGCTATCGTTATGTGCGATCCTTATACCCGTTGTGTTTTTTGTCCTGGAT
ATCGCAAAACCGAAAATCGCCGGATGGGGTACTTATGTCAGGTGGGTTGGTTCGGCTGCAGCAAGTGTCGTGGTT
TGGGAATGGGTGGAGCGGATCGAAGCATTGGAACGCGATGAGAGGAAGGATGGGATTCTTGGACGCGAAATATTT
GATGGAGATGAGATGTTGGAAGTGACCCCTTCGGAAGAAGTCGATTGGCCGCGCTACAATCCTGACGGCCATGAT
CGAGGCGGAGGCGGTGGAACGTCTTCAGGATGGGGAGGCATGATGGGACTGGCTCATCGTCCTTTACGTACGAGG
GTGGGTCGCAATTGGCAGTCGAACCTGGAGAACCAGCAACACAACATTCCCATGGACCCTCGGCGCCGGCGCATG
GCACCCCGACCAACTCCTCCCCCAGCAGCTATAACGCCTGTTAGTCGGGCCGACACAACCAGCGCGGCCAGTACG
GTATACAACATACATTATCATCCGGTGTCTAGTCCAACTCCACCGGTGGCCATGCCTCATATGGAGGAAGAGGAC
GAAGACATAGACGAAACGGTGGCTGCGAAGGAGATGACAACCGAAGGTCAGCAAGCTGGCCTAGCTCATGATGTG
CTGGCACAACAACAGACCCGGGAACAATCCCCTCAGATTGTGCACGTGGATAAAAGATGGCGAGCGCTGCTGAAT
CCTTTCAAACGAAGGCGTGCATCTTTGCCAAGAGAAGTCGCGTCTGCACAGGCCGAGGAAGAAGGGAATCCCGCA
GGTGCTCAAGTGGAACTGCAACGCCATTCTCTGGATGATAGCGACGATGAGCACAGCTTACAGCACAGGCACGAT
TTTCGGTTTGGCTTCCATCGAAGATTGCGACCCGGTTCTGGACGACAAGGCTCCGACTCGCCCTTGCCAGTCACG
GTCATTCCTGCTAGACGCCGTGGTCAACAGACCTGGTCGCCGCAGCAATATCATGAGCCTAGTTCACGAACAACA
ACTTCGAATCAGCGTGTTCCGCCTGGCCGTGATGACCTGCCTGTAAGGGTGATTCAGCCGCAAACGCGAACTGCT
GCTCCATGGAGCGCAGCCGATGGGCAAGGGTTCAGTCATGGCAACTATGAGCTGCGCTATGACCCTGAAGCTGCG
GCACTTGTGGAACCTGGTGAGAATTGCACTGAATCTCAGCCGGCGCTGGACGCCGATGGCTCGGTCAGCGAGCCT
ACTCGGGGGCCGGCTGGGCGCCAACAACCCGAGCAGGAATTCGACCCGATGGAAGGAGCACCTCTATCACCGGCT
CAACCTTTTCCTGACGAGGTCCCCGAAGATTCACGAGGGTCACATGGCCAGCAGTGA
Gene >Ani_SJS72_1|g6684.t1
ATGGGGGAACCCGCTCATCTAACGCCTCGCCAAATTTGGGCTCAACCGACGACAACGACCACCAGGACCTATGAA
GCTGACTGCACGCCGTTTCTATTACCCAGCTCTGGTATGTGGATTTGTGCTGGGCCCAATGCGGGCCGTCAAGCA
ACTCGCTTCCGTATGGTTACACTGACGCGGCGCTTCGGTGGGTGCTTTGCAGGTTACGTCTATTTGAATCGCTCC
TACTCCATCGCCTTGACCGAAAATGCCATCTACGATCCCATCTGTACGGGCACGGGCACAGCGACTGCCACGGCT
CATGCGGTCGCCGCGCTCGATGTCACCGACCCTTTTTATTCCTCCGTGACCCCGGCGTTGTATGCCATGGGCTGT
ACGACCGTTGTCAGCTATCTTCTCGTTATTATTCTTCTCATCACGCCGCGTACGTTTTATGTTGGAGGTCCTGGT
GGGGGTGCGAACTTTCTCGGACGTCATGGTATGATTAGCGGTTCGTATAGTGGTAATTCGTCGGTGGTCGGCGTT
GGTGGTCGCCCGTGGTTGCAGAAGGTCGCAGCCTTGTTAGTCGCGGTATCGCTCACCATCGCGACTGTGGACTCC
TTCCGTGTGGCTGAACAGCAATACTATTATGGTTACTCCGATGCCGAAGCGCTGGCCGACGAGGTCATCGACGGT
ATGGAGATCCGGGTGGTCAGAATCATTTCCAGCACCTTTTTGTGGCTGGCCCAGATTCAGACTTTGATTCGGCTA
TTCCCTCGACATAAGGAGAAAATAATGATCAAATGGGCAGGGTTCGCGTTAATCGTGTTCGATACGACATTTAGT
ATCCTCGACAAGTTCTTGGTCAAAACCGATACCGTTCACCCACGGCTCTATGAAGACGCGATTCCCGCTCTCAGC
TATCTGTTCGAACTTGCACTCAACCTATTGTACGCCGCTTGGGTCATCTTCTATTCGCTTTCGAAACATCGCTTC
GCCTTCTTCCATCCGAAAATGAGGAACATCTGCTTGGTGGCCTTGCTATCGTTATGTGCGATCCTTATACCCGTT
GTGTTTTTTGTCCTGGATATCGCAAAACCGAAAATCGCCGGATGGGGTACTTATGTCAGGTGGGTTGGTTCGGCT
GCAGCAAGTGTCGTGGTTTGGGAATGGGTGGAGCGGATCGAAGCATTGGAACGCGATGAGAGGAAGGATGGGATT
CTTGGACGCGAAATATTTGATGGAGATGAGATGTTGGAAGTGACCCCTTCGGAAGAAGTCGATTGGCCGCGCTAC
AATCCTGACGGCCATGATCGAGGCGGAGGCGGTGGAACGTCTTCAGGATGGGGAGGCATGATGGGACTGGCTCAT
CGTCCTTTACGTACGAGGGTGGGTCGCAATTGGCAGTCGAACCTGGAGAACCAGCAACACAACATTCCCATGGAC
CCTCGGCGCCGGCGCATGGCACCCCGACCAACTCCTCCCCCAGCAGCTATAACGCCTGTTAGTCGGGCCGACACA
ACCAGCGCGGCCAGTACGGTATACAACATACATTATCATCCGGTGTCTAGTCCAACTCCACCGGTGGCCATGCCT
CATATGGAGGAAGAGGACGAAGACATAGACGAAACGGTGGCTGCGAAGGAGATGACAACCGAAGGTCAGCAAGCT
GGCCTAGCTCATGATGTGCTGGCACAACAACAGACCCGGGAACAATCCCCTCAGATTGTGCACGTGGATAAAAGA
TGGCGAGCGCTGCTGAATCCTTTCAAACGAAGGCGTGCATCTTTGCCAAGAGAAGTCGCGTCTGCACAGGCCGAG
GAAGAAGGGAATCCCGCAGGTGCTCAAGTGGAACTGCAACGCCATTCTCTGGATGATAGCGACGATGAGCACAGC
TTACAGCACAGGCACGATTTTCGGTTTGGCTTCCATCGAAGATTGCGACCCGGTTCTGGACGACAAGGCTCCGAC
TCGCCCTTGCCAGTCACGGTCATTCCTGCTAGACGCCGTGGTCAACAGACCTGGTCGCCGCAGCAATATCATGAG
CCTAGTTCACGAACAACAACTTCGAATCAGCGTGTTCCGCCTGGCCGTGATGACCTGCCTGTAAGGGTGATTCAG
CCGCAAACGCGAACTGCTGCTCCATGGAGCGCAGCCGATGGGCAAGGGTTCAGTCATGGCAACTATGAGCTGCGC
TATGACCCTGAAGCTGCGGCACTTGTGGAACCTGGTGAGAATTGCACTGAATCTCAGCCGGCGCTGGACGCCGAT
GGCTCGGTCAGCGAGCCTACTCGGGGGCCGGCTGGGCGCCAACAACCCGAGCAGGAATTCGACCCGATGGAAGGA
GCACCTCTATCACCGGCTCAACCTTTTCCTGACGAGGTCCCCGAAGATTCACGAGGGTCACATGGCCAGCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail