Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g666.t1
Gene name
Locationscaffold_003:296378..298436
Strand+
Gene length (bp)2058
Transcript length (bp)1944
Coding sequence length (bp)1944
Protein length (aa) 648

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20143 NAD_kinase_C ATP-NAD kinase C-terminal domain 9.9E-38 438 563
PF01513 NAD_kinase ATP-NAD kinase N-terminal domain 6.1E-27 283 415

GO

GO Term Description Terminal node
GO:0006741 NADP biosynthetic process Yes
GO:0003951 NAD+ kinase activity Yes
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0019363 pyridine nucleotide biosynthetic process No
GO:0044281 small molecule metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0003674 molecular_function No
GO:0009058 biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0090407 organophosphate biosynthetic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0009165 nucleotide biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0072525 pyridine-containing compound biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0006793 phosphorus metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0008152 metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:0019637 organophosphate metabolic process No
GO:0072524 pyridine-containing compound metabolic process No
GO:0016301 kinase activity No
GO:0044237 cellular metabolic process No
GO:0009117 nucleotide metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0019362 pyridine nucleotide metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044238 primary metabolic process No
GO:1901293 nucleoside phosphate biosynthetic process No
GO:0016740 transferase activity No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0006753 nucleoside phosphate metabolic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0046496 nicotinamide nucleotide metabolic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006739 NADP metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0019359 nicotinamide nucleotide biosynthetic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

Gene cluster ID Type of secondary metabolism gene
Cluster 6 (None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID3
Orthogroup5089
Change Orthofinder run
Species Protein ID
Aspergillus niger CBS 112.32 Ani_SJS6_1|g4323.t1
Aspergillus niger CBS 113.50 Ani_SJS3_1|g7114.t1
Aspergillus niger CBS 115988 Ani_SJS16_1|g328.t1
Aspergillus niger CBS 115989 Ani_SJS83_1|g2308.t1
Aspergillus niger CBS 118.52 Ani_SJS14_1|g7745.t1
Aspergillus niger CBS 124.48 Ani_SJS7_1|g6652.t1
Aspergillus niger CBS 131.52 Ani_SJS8_1|g6009.t1
Aspergillus niger CBS 133816 Ani_SJS71_1|g2383.t1
Aspergillus niger CBS 147320 Ani_SJS28_1|g4619.t1
Aspergillus niger CBS 147321 Ani_SJS30_1|g7282.t1
Aspergillus niger CBS 147322 Ani_SJS35_1|g5046.t1
Aspergillus niger CBS 147323 Ani_SJS38_1|g4772.t1
Aspergillus niger CBS 147324 Ani_SJS39_1|g4295.t1
Aspergillus niger CBS 147343 Ani_SJS115_1|g8424.t1
Aspergillus niger CBS 147344 Ani_SJS70_1|g5012.t1
Aspergillus niger CBS 147345 Ani_SJS72_1|g666.t1 (this protein)
Aspergillus niger CBS 147346 Ani_SJS75_1|g2183.t1
Aspergillus niger CBS 147347 Ani_SJS76_1|g3538.t1
Aspergillus niger CBS 147352 Ani_SJS95_1|g4243.t1
Aspergillus niger CBS 147353 Ani_SJS100_1|g4808.t1
Aspergillus niger CBS 147371 Ani_SJS27_1|g3607.t1
Aspergillus niger CBS 147482 Ani_SJS55_1|g1886.t1
Aspergillus niger CBS 630.78 Ani_SJS18_1|g2792.t1
Aspergillus niger CBS 769.97 Ani_SJS82_1|g6402.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g666.t1
MASSPLDHGSMNPSSASSSDPLPATGPLPSPSISLPSSPPPPPSSAAPPLSDPPVRPPPPHRSATVGASLLRDYA
LHIDPSHTTNDIHAADSAPESPNLGLGSLQKPDLPREGAAGPSFTSSFLPRRQTASLAGHHRNALSNDSIPRQTL
LKALASRPSMCNHQSPNMPLAASLGLLNTNPTSSEETERNSSNSSSQMLSAALSNIQLGTYLDRSPATARLVMQS
PCFFHQRFDDAVNIQKVLEEIADDEWLSHSRLVQTATGVREVSKQLQRRPIKRAVKNVMIVTKARDNSLVHLTRE
LAEWLLSTPRYGNDLGVNVYVDAKLRNSRRFDAPGLLEKEPRFKEMLHYWTPDLCWTAPEKFDLVLTLGGDGTVL
FTSWLFQRIVPPVLCFSLGSLGFLTNFEFENYKSHLNAVMGDVDRSKGAEAGAVEEGEQFEVLNELVIDRGPSPY
VSNLELYADNDLLTVVQADGCIFSTPTGSTAYSLSAGGSLIHPSIPGILLTPICPHTLSFRPMVLSDTLLLRIAV
PAGSRSTAYCSFDGKGRVELRQGDYVTVEASQYPFPTVVAGSGEWFQSVQRALRWNTRGAVQKSWHSSSDAGLEA
TEDDEDTEWDIDTDAGLTGTDSGLGVSEDGDAGSISPLKRQMSMFST*
Coding >Ani_SJS72_1|g666.t1
ATGGCGTCCTCCCCACTTGACCATGGCTCGATGAACCCTTCTTCTGCCTCGTCCTCCGATCCGCTGCCCGCGACC
GGCCCTCTGCCGTCGCCCTCAATATCTTTGCCCTCATCACCACCACCACCGCCGTCCTCCGCGGCCCCACCACTA
TCAGATCCTCCGGTGCGCCCTCCTCCTCCTCATCGCTCGGCCACTGTGGGAGCATCGCTCCTCCGCGACTATGCC
TTGCACATAGATCCTTCTCACACGACAAACGATATCCACGCAGCCGACTCGGCTCCCGAGTCTCCCAATCTGGGT
CTCGGCTCACTTCAGAAACCTGATCTTCCTCGTGAGGGTGCCGCTGGTCCCTCTTTCACCTCGTCCTTCCTGCCA
CGCCGGCAGACGGCCTCTCTAGCGGGCCATCATCGGAACGCGTTGTCTAACGATTCAATTCCTCGCCAAACCCTT
CTCAAAGCTCTCGCATCACGACCATCCATGTGCAACCACCAAAGCCCAAACATGCCGCTGGCGGCCTCTTTGGGG
CTTCTCAACACGAACCCTACCTCCTCGGAAGAAACGGAGCGCAACTCCAGCAATTCCTCGTCACAGATGCTCTCT
GCAGCTCTGTCCAATATTCAGCTAGGGACCTACCTGGACCGTTCTCCCGCGACAGCCCGGTTGGTTATGCAGTCA
CCATGCTTCTTCCACCAGCGTTTCGATGACGCCGTAAATATTCAGAAGGTATTGGAAGAGATTGCGGACGACGAG
TGGCTATCGCATTCCCGCCTGGTACAGACAGCGACTGGTGTCCGAGAGGTGTCGAAGCAATTGCAGCGTAGGCCA
ATCAAACGCGCTGTCAAGAATGTTATGATCGTCACCAAAGCACGCGATAATAGCCTGGTGCATCTGACCCGCGAA
TTGGCGGAATGGCTCCTCTCCACCCCTCGCTACGGCAACGATTTGGGTGTGAACGTCTACGTAGACGCTAAACTT
CGGAACTCACGAAGATTCGATGCACCGGGGCTCCTGGAGAAGGAACCCCGGTTCAAGGAGATGCTGCACTACTGG
ACCCCCGATCTCTGCTGGACAGCTCCCGAGAAATTCGATTTGGTCCTCACATTAGGAGGGGATGGGACCGTGCTT
TTCACATCCTGGCTCTTCCAGCGCATCGTCCCCCCGGTCCTCTGCTTTTCTCTGGGAAGCCTAGGGTTCCTGACG
AATTTCGAGTTTGAGAATTACAAGTCTCACCTGAATGCGGTCATGGGTGATGTAGACCGCAGCAAGGGCGCCGAG
GCGGGCGCCGTGGAGGAAGGGGAGCAGTTTGAGGTGTTGAACGAGCTCGTGATTGATCGAGGGCCGTCACCATAC
GTGTCAAACCTTGAACTGTACGCAGATAATGATCTGCTCACCGTGGTGCAAGCGGACGGGTGCATTTTCTCTACT
CCTACCGGTTCCACGGCATACTCTCTTTCCGCTGGCGGTTCCTTGATTCACCCCTCTATTCCCGGCATTCTTCTT
ACCCCCATTTGTCCCCATACACTTTCTTTCCGTCCCATGGTTCTCTCCGATACCCTGCTACTTCGTATTGCCGTT
CCCGCCGGGTCGCGGTCGACCGCGTACTGCTCGTTCGATGGCAAGGGTCGTGTGGAACTTCGCCAAGGCGACTAT
GTTACCGTCGAAGCAAGTCAATACCCCTTCCCGACCGTCGTGGCGGGTAGTGGAGAGTGGTTCCAGAGCGTTCAG
CGAGCGCTGCGGTGGAATACACGCGGTGCCGTGCAGAAGAGCTGGCACAGCTCTTCAGATGCGGGCCTCGAAGCC
ACCGAGGATGATGAAGACACCGAGTGGGACATCGATACCGATGCCGGGCTAACTGGCACGGACAGTGGCTTGGGG
GTCAGTGAGGATGGCGATGCAGGGTCTATCAGCCCTCTGAAGCGGCAAATGAGCATGTTCAGCACCTAG
Transcript >Ani_SJS72_1|g666.t1
ATGGCGTCCTCCCCACTTGACCATGGCTCGATGAACCCTTCTTCTGCCTCGTCCTCCGATCCGCTGCCCGCGACC
GGCCCTCTGCCGTCGCCCTCAATATCTTTGCCCTCATCACCACCACCACCGCCGTCCTCCGCGGCCCCACCACTA
TCAGATCCTCCGGTGCGCCCTCCTCCTCCTCATCGCTCGGCCACTGTGGGAGCATCGCTCCTCCGCGACTATGCC
TTGCACATAGATCCTTCTCACACGACAAACGATATCCACGCAGCCGACTCGGCTCCCGAGTCTCCCAATCTGGGT
CTCGGCTCACTTCAGAAACCTGATCTTCCTCGTGAGGGTGCCGCTGGTCCCTCTTTCACCTCGTCCTTCCTGCCA
CGCCGGCAGACGGCCTCTCTAGCGGGCCATCATCGGAACGCGTTGTCTAACGATTCAATTCCTCGCCAAACCCTT
CTCAAAGCTCTCGCATCACGACCATCCATGTGCAACCACCAAAGCCCAAACATGCCGCTGGCGGCCTCTTTGGGG
CTTCTCAACACGAACCCTACCTCCTCGGAAGAAACGGAGCGCAACTCCAGCAATTCCTCGTCACAGATGCTCTCT
GCAGCTCTGTCCAATATTCAGCTAGGGACCTACCTGGACCGTTCTCCCGCGACAGCCCGGTTGGTTATGCAGTCA
CCATGCTTCTTCCACCAGCGTTTCGATGACGCCGTAAATATTCAGAAGGTATTGGAAGAGATTGCGGACGACGAG
TGGCTATCGCATTCCCGCCTGGTACAGACAGCGACTGGTGTCCGAGAGGTGTCGAAGCAATTGCAGCGTAGGCCA
ATCAAACGCGCTGTCAAGAATGTTATGATCGTCACCAAAGCACGCGATAATAGCCTGGTGCATCTGACCCGCGAA
TTGGCGGAATGGCTCCTCTCCACCCCTCGCTACGGCAACGATTTGGGTGTGAACGTCTACGTAGACGCTAAACTT
CGGAACTCACGAAGATTCGATGCACCGGGGCTCCTGGAGAAGGAACCCCGGTTCAAGGAGATGCTGCACTACTGG
ACCCCCGATCTCTGCTGGACAGCTCCCGAGAAATTCGATTTGGTCCTCACATTAGGAGGGGATGGGACCGTGCTT
TTCACATCCTGGCTCTTCCAGCGCATCGTCCCCCCGGTCCTCTGCTTTTCTCTGGGAAGCCTAGGGTTCCTGACG
AATTTCGAGTTTGAGAATTACAAGTCTCACCTGAATGCGGTCATGGGTGATGTAGACCGCAGCAAGGGCGCCGAG
GCGGGCGCCGTGGAGGAAGGGGAGCAGTTTGAGGTGTTGAACGAGCTCGTGATTGATCGAGGGCCGTCACCATAC
GTGTCAAACCTTGAACTGTACGCAGATAATGATCTGCTCACCGTGGTGCAAGCGGACGGGTGCATTTTCTCTACT
CCTACCGGTTCCACGGCATACTCTCTTTCCGCTGGCGGTTCCTTGATTCACCCCTCTATTCCCGGCATTCTTCTT
ACCCCCATTTGTCCCCATACACTTTCTTTCCGTCCCATGGTTCTCTCCGATACCCTGCTACTTCGTATTGCCGTT
CCCGCCGGGTCGCGGTCGACCGCGTACTGCTCGTTCGATGGCAAGGGTCGTGTGGAACTTCGCCAAGGCGACTAT
GTTACCGTCGAAGCAAGTCAATACCCCTTCCCGACCGTCGTGGCGGGTAGTGGAGAGTGGTTCCAGAGCGTTCAG
CGAGCGCTGCGGTGGAATACACGCGGTGCCGTGCAGAAGAGCTGGCACAGCTCTTCAGATGCGGGCCTCGAAGCC
ACCGAGGATGATGAAGACACCGAGTGGGACATCGATACCGATGCCGGGCTAACTGGCACGGACAGTGGCTTGGGG
GTCAGTGAGGATGGCGATGCAGGGTCTATCAGCCCTCTGAAGCGGCAAATGAGCATGTTCAGCACCTAG
Gene >Ani_SJS72_1|g666.t1
ATGGCGTCCTCCCCACTTGACCATGGCTCGATGAACCCTTCTTCTGCCTCGTCCTCCGATCCGCTGCCCGCGACC
GGCCCTCTGCCGTCGCCCTCAATATCTTTGCCCTCATCACCACCACCACCGCCGTCCTCCGCGGCCCCACCACTA
TCAGATCCTCCGGTGCGCCCTCCTCCTCCTCATCGCTCGGCCACTGTGGGAGCATCGCTCCTCCGCGACTATGCC
TTGCACATAGATCCTTCTCACACGACAAACGATATCCACGCAGCCGACTCGGCTCCCGAGTCTCCCAATCTGGGT
CTCGGCTCACTTCAGAAACCTGATCTTCCTCGTGAGGGTGCCGCTGGTCCCTCTTTCACCTCGTCCTTCCTGCCA
CGCCGGCAGACGGCCTCTCTAGCGGGCCATCATCGGAACGCGTTGTCTAACGATTCAATTCCTCGCCAAACCCTT
CTCAAAGCTCTCGCATCACGACCATCCATGTGCAACCACCAAAGCCCAAACATGCCGCTGGCGGCCTCTTTGGGG
CTTCTCAACACGAACCCTACCTCCTCGGAAGAAACGGAGCGCAACTCCAGCAATTCCTCGTCACAGATGCTCTCT
GCAGCTCTGTCCAATATTCAGCTAGGGACCTACCTGGACCGTTCTCCCGCGACAGCCCGGTTGGTTATGCAGTCA
CCATGCTTCTTCCACCAGCGTTTCGATGACGCCGTAAATATTCAGAAGGTATTGGAAGAGATTGCGGACGACGAG
TGGCTATCGCATTCCCGCCTGGTACAGACAGCGACTGGTGTCCGAGAGGTGTCGAAGCAATTGCAGCGTAGGCCA
ATCAAACGCGCTGTCAAGAATGTTATGATCGTCACCAAAGCACGCGATAATAGCCTGGTGCATCTGACCCGCGAA
TTGGCGGAATGGCTCCTCTCCACCCCTCGCTACGGCAACGATTTGGGTGTGAACGTCTACGTAGACGCTAAACTT
CGGAACTCACGAAGATTCGATGCACCGGGGCTCCTGGAGAAGGAACCCCGGTTCAAGGAGATGCTGCACTACTGG
ACCCCCGATCTCTGCTGGACAGCTCCCGAGAAATTCGATTTGGTCCTCACATTAGGAGGGGATGGGACCGTGCTT
TTCACATCCTGGCTCTTCCAGCGCATCGTCCCCCCGGTCCTCTGCTTTTCTCTGGGAAGCCTAGGGTTCCTGACG
AATTTCGAGTTTGAGAATTACAAGTCTCACCTGAATGCGGTCATGGGTGATGTAGGTATGCGAGTGAATTTGCGG
ATGCGCTTTACTTGTACAGTTTTCCGTAAAGACCGCAGCAAGGGCGCCGAGGCGGGCGCCGTGGAGGAAGGGGAG
CAGTTTGAGGTGTTGAACGAGCTCGTGATTGATCGAGGGCCGTCACCATACGTGTCAAACCTTGAACTGTACGCA
GATAATGATCTGCTCACCGTGGTGCAAGCGGACGGGTGCATTTTCTCTACTCCTACCGGTACGTGTGACCCGCAA
AAACAACAGACTGATTTTCAAATCACCGACTGACATGTGGTCTCAGGTTCCACGGCATACTCTCTTTCCGCTGGC
GGTTCCTTGATTCACCCCTCTATTCCCGGCATTCTTCTTACCCCCATTTGTCCCCATACACTTTCTTTCCGTCCC
ATGGTTCTCTCCGATACCCTGCTACTTCGTATTGCCGTTCCCGCCGGGTCGCGGTCGACCGCGTACTGCTCGTTC
GATGGCAAGGGTCGTGTGGAACTTCGCCAAGGCGACTATGTTACCGTCGAAGCAAGTCAATACCCCTTCCCGACC
GTCGTGGCGGGTAGTGGAGAGTGGTTCCAGAGCGTTCAGCGAGCGCTGCGGTGGAATACACGCGGTGCCGTGCAG
AAGAGCTGGCACAGCTCTTCAGATGCGGGCCTCGAAGCCACCGAGGATGATGAAGACACCGAGTGGGACATCGAT
ACCGATGCCGGGCTAACTGGCACGGACAGTGGCTTGGGGGTCAGTGAGGATGGCGATGCAGGGTCTATCAGCCCT
CTGAAGCGGCAAATGAGCATGTTCAGCACCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail