Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g658.t1
Gene name
Locationscaffold_003:268646..272820
Strand+
Gene length (bp)4174
Transcript length (bp)3123
Coding sequence length (bp)3123
Protein length (aa) 1041

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09427 DUF2014 Domain of unknown function (DUF2014) 4.4E-107 561 823
PF00010 HLH Helix-loop-helix DNA-binding domain 7.6E-18 222 293

GO

GO Term Description Terminal node
GO:0046983 protein dimerization activity Yes
GO:0032933 SREBP signaling pathway Yes
GO:0045944 positive regulation of transcription by RNA polymerase II Yes
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0006984 ER-nucleus signaling pathway No
GO:2001141 regulation of RNA biosynthetic process No
GO:0045935 positive regulation of nucleobase-containing compound metabolic process No
GO:0051173 positive regulation of nitrogen compound metabolic process No
GO:1902680 positive regulation of RNA biosynthetic process No
GO:1903508 positive regulation of nucleic acid-templated transcription No
GO:0019222 regulation of metabolic process No
GO:0003674 molecular_function No
GO:0045893 positive regulation of transcription, DNA-templated No
GO:0006991 response to sterol depletion No
GO:0048522 positive regulation of cellular process No
GO:0050794 regulation of cellular process No
GO:0051254 positive regulation of RNA metabolic process No
GO:0031325 positive regulation of cellular metabolic process No
GO:0005488 binding No
GO:0065007 biological regulation No
GO:0031328 positive regulation of cellular biosynthetic process No
GO:0048518 positive regulation of biological process No
GO:0010468 regulation of gene expression No
GO:0080090 regulation of primary metabolic process No
GO:0008150 biological_process No
GO:0031326 regulation of cellular biosynthetic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0009889 regulation of biosynthetic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0006355 regulation of transcription, DNA-templated No
GO:0009893 positive regulation of metabolic process No
GO:0009891 positive regulation of biosynthetic process No
GO:0050896 response to stimulus No
GO:0010604 positive regulation of macromolecule metabolic process No
GO:0071501 cellular response to sterol depletion No
GO:0006950 response to stress No
GO:0033554 cellular response to stress No
GO:0050789 regulation of biological process No
GO:0007165 signal transduction No
GO:0031323 regulation of cellular metabolic process No
GO:0010557 positive regulation of macromolecule biosynthetic process No
GO:0006357 regulation of transcription by RNA polymerase II No
GO:0051716 cellular response to stimulus No
GO:0060255 regulation of macromolecule metabolic process No
GO:0051252 regulation of RNA metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0005515 protein binding No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 461 480 19
2 487 509 22

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Helix-loop-helix

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g658.t1
MHLLHPASCIARPSLPYPRHWRAEARLVEVGDNLAGDLNPQLAASLLTFPPQPGIHLRATRRRALTLSIASSDRR
DSQAESTTFAQSTTEDSSQDWTQWMRWDDKGFADGAKDVSHSPFDTTFTSPNASIGNTDLFQKSDFSPDINLDCT
NIPFDSLLDQNYSGVCQSKIGSIGTDLQSALSATSGSPLSSEGTARKRKSGSDDDGSTVSGVMPTGKKMPAKKRA
HNVIEKRYRANLNEKIAELRDSVPSLRASKNASGNLLEDDDGEGVTPANKLNKASILSKATEYIRHLEIRNKRLE
DENMALKNRLRQAEKAVDQSLTSAASVSSPSNYTVSTESGASSSPSVFSHVEDSPSDHSPTSLYPPEGLLKVPDA
FKRMREESTAKDNAFSQSYIQYPSSNNSVSSPCGGRTRRSYYPNKYMLGALAGLMIVEGMGSEKNTESTAKGLLA
MPFNLFGNLQTSLQSPTAAYWFAMARNFWYSWHARAISHFLILATLVVGSAFVVFVYLFNATPGEQSSSLKTSSP
SDTSSNFRRQAWLTSIQRVGVPRHRFFHEWYVVTSRCFEYVLRCLLGWKLYSSLTGVTEEDEKGRVKTWDIAIDA
QLAGGDAEISKSRLVLTIFAAGTLPRSPMRMMLKALHCRILLWRVGDRGSWSFDLSNDVARSLARYQWDLARKMH
KAMPKDHPDALPSHLAALLQLDCDEVMIDSIVQRAANLTWNRPTQEGTDDDQALLDVVEEDPAIQSSLDALAAWW
SSHLLQRALLRYFEASSGGPDAKKSRDLFKAKIKLALDVAPQPSAAHTRALVMKAVFFEQDRAANIGSVLAALPK
DKGKSKQNQASNFLDSSLPVSVREEIAISVRCAMIAAIFTARTTGDTSLPASFTIQRAVTWFNQLPLDPVDLTLL
GFASVYHLLHVLASDTDYLSSSESSSPSSPVSRSSTPSSSVSSDEEGNDKPRLSQKPEILPQSIPNLGRVASELM
YWARNAYNPAFYGFTSQLVKVIETECTSLCHSAGVDVADYSCIQEEKIKSKQLKDKKKKKYPRRS*
Coding >Ani_SJS72_1|g658.t1
ATGCACCTCTTGCATCCAGCTAGCTGCATCGCTAGACCGTCCTTACCGTACCCAAGACATTGGAGAGCGGAAGCG
CGTCTGGTTGAGGTGGGTGATAACCTCGCCGGTGACTTGAACCCGCAACTAGCCGCATCGCTCCTGACCTTTCCC
CCTCAGCCGGGAATTCACCTCCGTGCGACTCGCCGCAGGGCACTGACGTTATCAATTGCGTCGTCGGATAGAAGA
GACTCACAGGCCGAGTCTACGACCTTCGCTCAGTCTACAACGGAAGATTCCAGTCAGGATTGGACGCAGTGGATG
AGATGGGATGACAAGGGCTTTGCGGATGGGGCAAAAGACGTCTCTCACTCCCCCTTCGATACTACCTTCACCTCG
CCCAATGCGTCAATTGGCAACACAGATCTCTTTCAAAAGTCCGACTTCTCACCCGACATCAACCTGGATTGTACC
AATATTCCCTTTGATTCCTTGCTCGATCAAAATTACAGTGGCGTGTGCCAATCGAAGATCGGATCCATTGGTACC
GATCTCCAGTCGGCACTCTCCGCTACGTCCGGCTCTCCGTTATCCTCGGAAGGAACTGCTCGCAAACGCAAGTCG
GGCAGTGATGATGATGGCTCAACCGTCAGTGGAGTCATGCCGACCGGTAAGAAGATGCCGGCCAAAAAGCGAGCA
CACAACGTCATCGAGAAGAGGTATCGAGCCAACCTTAATGAGAAGATTGCCGAGCTGAGGGACAGTGTGCCCAGT
CTCCGAGCGTCAAAAAATGCGTCGGGTAATCTCCTGGAAGATGACGATGGAGAAGGGGTCACTCCCGCCAACAAG
TTGAACAAGGCCTCTATTCTCTCAAAAGCCACAGAGTATATTCGTCACCTTGAGATCCGTAATAAGCGACTTGAG
GATGAGAACATGGCATTGAAGAACCGACTTCGTCAAGCGGAAAAGGCCGTTGACCAGTCACTGACCTCCGCAGCG
TCCGTTTCCTCACCCAGCAACTACACCGTTTCCACAGAATCTGGCGCAAGCTCATCCCCCAGTGTGTTCTCACAT
GTGGAGGATAGTCCTAGCGACCACTCGCCGACGTCTTTGTATCCTCCCGAAGGTCTGCTGAAGGTGCCCGATGCC
TTCAAACGCATGCGAGAGGAATCCACCGCTAAAGATAACGCGTTCTCTCAATCATACATCCAATACCCCAGCAGC
AATAACAGTGTCTCATCCCCATGCGGTGGTCGTACCAGGCGATCATATTACCCCAACAAGTACATGCTTGGTGCC
CTTGCTGGCTTAATGATCGTCGAGGGTATGGGCAGCGAAAAGAACACGGAATCAACCGCCAAGGGGCTGCTGGCA
ATGCCATTCAACCTGTTCGGAAACTTGCAAACCAGCCTCCAAAGTCCCACAGCAGCATACTGGTTTGCAATGGCA
CGAAACTTTTGGTATTCGTGGCATGCACGAGCCATCTCGCATTTTCTTATTCTCGCTACCCTTGTCGTCGGTAGT
GCATTCGTGGTCTTCGTTTATTTGTTCAACGCTACCCCCGGCGAACAGTCCTCTTCATTGAAGACTTCGTCACCA
TCGGATACATCGTCAAATTTCCGGCGCCAGGCCTGGCTGACGAGCATACAGCGAGTCGGTGTTCCACGTCACCGC
TTTTTCCACGAGTGGTACGTAGTGACCTCGCGCTGCTTCGAGTATGTCCTGCGGTGTCTCCTGGGCTGGAAACTG
TACTCTTCTCTTACAGGAGTTACCGAGGAGGACGAGAAGGGGCGAGTCAAGACCTGGGATATTGCAATCGACGCA
CAATTGGCTGGTGGTGATGCCGAAATTAGTAAGAGTCGTCTAGTCCTGACTATCTTTGCGGCAGGCACCCTGCCT
CGGAGTCCTATGAGGATGATGCTCAAAGCCCTCCACTGCCGCATTCTGCTCTGGAGAGTTGGGGACCGCGGCTCT
TGGAGCTTCGACTTGTCGAATGATGTCGCTCGTTCACTGGCAAGGTATCAATGGGACCTCGCCCGGAAAATGCAC
AAGGCTATGCCGAAAGACCATCCTGATGCCCTGCCTAGTCATCTGGCTGCGTTGTTACAACTGGACTGCGACGAG
GTCATGATTGACAGCATCGTGCAAAGAGCGGCAAACCTCACTTGGAATCGTCCCACTCAAGAAGGTACCGATGAT
GATCAAGCTCTCCTGGATGTGGTGGAAGAGGACCCTGCCATTCAATCTTCCCTGGATGCCCTTGCGGCTTGGTGG
TCTAGCCATCTTTTGCAACGGGCGCTGCTGAGATATTTCGAAGCTAGCTCCGGTGGGCCTGACGCAAAGAAGAGT
CGCGATCTATTCAAGGCTAAGATTAAATTGGCCCTGGACGTCGCTCCCCAGCCTTCAGCCGCTCATACTCGAGCT
TTGGTGATGAAGGCAGTATTCTTCGAGCAAGACCGCGCTGCGAATATCGGATCCGTCCTTGCGGCATTGCCGAAA
GACAAAGGGAAGAGCAAACAAAACCAAGCATCCAACTTCCTTGACTCGTCTCTTCCCGTGTCTGTGCGGGAAGAG
ATCGCGATATCAGTTCGCTGTGCAATGATTGCGGCCATTTTTACCGCTAGGACTACAGGCGACACCTCTCTACCG
GCGTCCTTTACCATCCAAAGAGCTGTTACGTGGTTCAATCAGTTGCCGCTTGACCCGGTGGATCTGACGCTTCTT
GGGTTTGCGTCTGTGTACCATTTGCTCCATGTCTTAGCTTCTGACACCGACTATCTGTCGTCTTCCGAGTCCTCA
TCGCCATCTTCGCCTGTATCGCGCAGCTCCACCCCGTCGTCTTCGGTTTCCTCTGACGAAGAGGGGAATGACAAG
CCACGCCTGTCGCAGAAGCCCGAGATTTTGCCGCAATCCATTCCGAATTTGGGTCGTGTAGCATCCGAACTCATG
TACTGGGCGCGGAATGCATACAATCCTGCTTTCTACGGTTTCACTTCTCAACTTGTCAAGGTCATCGAAACCGAA
TGCACCTCGCTATGCCATAGTGCCGGGGTCGACGTGGCCGACTACTCTTGTATCCAGGAGGAGAAGATCAAGTCG
AAACAATTAAAAGACAAAAAGAAGAAAAAGTACCCGAGAAGGTCGTGA
Transcript >Ani_SJS72_1|g658.t1
ATGCACCTCTTGCATCCAGCTAGCTGCATCGCTAGACCGTCCTTACCGTACCCAAGACATTGGAGAGCGGAAGCG
CGTCTGGTTGAGGTGGGTGATAACCTCGCCGGTGACTTGAACCCGCAACTAGCCGCATCGCTCCTGACCTTTCCC
CCTCAGCCGGGAATTCACCTCCGTGCGACTCGCCGCAGGGCACTGACGTTATCAATTGCGTCGTCGGATAGAAGA
GACTCACAGGCCGAGTCTACGACCTTCGCTCAGTCTACAACGGAAGATTCCAGTCAGGATTGGACGCAGTGGATG
AGATGGGATGACAAGGGCTTTGCGGATGGGGCAAAAGACGTCTCTCACTCCCCCTTCGATACTACCTTCACCTCG
CCCAATGCGTCAATTGGCAACACAGATCTCTTTCAAAAGTCCGACTTCTCACCCGACATCAACCTGGATTGTACC
AATATTCCCTTTGATTCCTTGCTCGATCAAAATTACAGTGGCGTGTGCCAATCGAAGATCGGATCCATTGGTACC
GATCTCCAGTCGGCACTCTCCGCTACGTCCGGCTCTCCGTTATCCTCGGAAGGAACTGCTCGCAAACGCAAGTCG
GGCAGTGATGATGATGGCTCAACCGTCAGTGGAGTCATGCCGACCGGTAAGAAGATGCCGGCCAAAAAGCGAGCA
CACAACGTCATCGAGAAGAGGTATCGAGCCAACCTTAATGAGAAGATTGCCGAGCTGAGGGACAGTGTGCCCAGT
CTCCGAGCGTCAAAAAATGCGTCGGGTAATCTCCTGGAAGATGACGATGGAGAAGGGGTCACTCCCGCCAACAAG
TTGAACAAGGCCTCTATTCTCTCAAAAGCCACAGAGTATATTCGTCACCTTGAGATCCGTAATAAGCGACTTGAG
GATGAGAACATGGCATTGAAGAACCGACTTCGTCAAGCGGAAAAGGCCGTTGACCAGTCACTGACCTCCGCAGCG
TCCGTTTCCTCACCCAGCAACTACACCGTTTCCACAGAATCTGGCGCAAGCTCATCCCCCAGTGTGTTCTCACAT
GTGGAGGATAGTCCTAGCGACCACTCGCCGACGTCTTTGTATCCTCCCGAAGGTCTGCTGAAGGTGCCCGATGCC
TTCAAACGCATGCGAGAGGAATCCACCGCTAAAGATAACGCGTTCTCTCAATCATACATCCAATACCCCAGCAGC
AATAACAGTGTCTCATCCCCATGCGGTGGTCGTACCAGGCGATCATATTACCCCAACAAGTACATGCTTGGTGCC
CTTGCTGGCTTAATGATCGTCGAGGGTATGGGCAGCGAAAAGAACACGGAATCAACCGCCAAGGGGCTGCTGGCA
ATGCCATTCAACCTGTTCGGAAACTTGCAAACCAGCCTCCAAAGTCCCACAGCAGCATACTGGTTTGCAATGGCA
CGAAACTTTTGGTATTCGTGGCATGCACGAGCCATCTCGCATTTTCTTATTCTCGCTACCCTTGTCGTCGGTAGT
GCATTCGTGGTCTTCGTTTATTTGTTCAACGCTACCCCCGGCGAACAGTCCTCTTCATTGAAGACTTCGTCACCA
TCGGATACATCGTCAAATTTCCGGCGCCAGGCCTGGCTGACGAGCATACAGCGAGTCGGTGTTCCACGTCACCGC
TTTTTCCACGAGTGGTACGTAGTGACCTCGCGCTGCTTCGAGTATGTCCTGCGGTGTCTCCTGGGCTGGAAACTG
TACTCTTCTCTTACAGGAGTTACCGAGGAGGACGAGAAGGGGCGAGTCAAGACCTGGGATATTGCAATCGACGCA
CAATTGGCTGGTGGTGATGCCGAAATTAGTAAGAGTCGTCTAGTCCTGACTATCTTTGCGGCAGGCACCCTGCCT
CGGAGTCCTATGAGGATGATGCTCAAAGCCCTCCACTGCCGCATTCTGCTCTGGAGAGTTGGGGACCGCGGCTCT
TGGAGCTTCGACTTGTCGAATGATGTCGCTCGTTCACTGGCAAGGTATCAATGGGACCTCGCCCGGAAAATGCAC
AAGGCTATGCCGAAAGACCATCCTGATGCCCTGCCTAGTCATCTGGCTGCGTTGTTACAACTGGACTGCGACGAG
GTCATGATTGACAGCATCGTGCAAAGAGCGGCAAACCTCACTTGGAATCGTCCCACTCAAGAAGGTACCGATGAT
GATCAAGCTCTCCTGGATGTGGTGGAAGAGGACCCTGCCATTCAATCTTCCCTGGATGCCCTTGCGGCTTGGTGG
TCTAGCCATCTTTTGCAACGGGCGCTGCTGAGATATTTCGAAGCTAGCTCCGGTGGGCCTGACGCAAAGAAGAGT
CGCGATCTATTCAAGGCTAAGATTAAATTGGCCCTGGACGTCGCTCCCCAGCCTTCAGCCGCTCATACTCGAGCT
TTGGTGATGAAGGCAGTATTCTTCGAGCAAGACCGCGCTGCGAATATCGGATCCGTCCTTGCGGCATTGCCGAAA
GACAAAGGGAAGAGCAAACAAAACCAAGCATCCAACTTCCTTGACTCGTCTCTTCCCGTGTCTGTGCGGGAAGAG
ATCGCGATATCAGTTCGCTGTGCAATGATTGCGGCCATTTTTACCGCTAGGACTACAGGCGACACCTCTCTACCG
GCGTCCTTTACCATCCAAAGAGCTGTTACGTGGTTCAATCAGTTGCCGCTTGACCCGGTGGATCTGACGCTTCTT
GGGTTTGCGTCTGTGTACCATTTGCTCCATGTCTTAGCTTCTGACACCGACTATCTGTCGTCTTCCGAGTCCTCA
TCGCCATCTTCGCCTGTATCGCGCAGCTCCACCCCGTCGTCTTCGGTTTCCTCTGACGAAGAGGGGAATGACAAG
CCACGCCTGTCGCAGAAGCCCGAGATTTTGCCGCAATCCATTCCGAATTTGGGTCGTGTAGCATCCGAACTCATG
TACTGGGCGCGGAATGCATACAATCCTGCTTTCTACGGTTTCACTTCTCAACTTGTCAAGGTCATCGAAACCGAA
TGCACCTCGCTATGCCATAGTGCCGGGGTCGACGTGGCCGACTACTCTTGTATCCAGGAGGAGAAGATCAAGTCG
AAACAATTAAAAGACAAAAAGAAGAAAAAGTACCCGAGAAGGTCGTGA
Gene >Ani_SJS72_1|g658.t1
ATGCACCTCTTGCATCCAGCTAGCTGCATCGCTAGACCGTCCTTACCGTACCCAAGACATTGGAGAGTGAGTAAG
TGGGACCCCGAGGCATGTTATTTTTAGTTTTGCCGCAGCCTCATTGGCTGATTAAGTAGGCGGAAGGTACGAATA
CACCATCTAACCATACATACAATACGTGCTCCCCCACTACTATAGCACTTTTCACCACGTGATGGTAATATAGAA
ACACCTTCCTTACTCACTCCCGTACATCTGGCGCCACTCGATGAAGTGACTGAAAGAGTCTGGCTCGGTTTGCCG
GAAGCGCCGTCTCCCGCGATCATACGACGCCCACCACCGAGTCTTGGCCGAGGATCACCGCCCGCCTTTGCCTTC
AGGCAGCGCAATTGGGGATGGAGTTCATTCAGTCGTCCACGCCTTTCGCTTTTCCTTTCTCGGTCGCTTGTGATT
TGGACGGGCTGCCCACCTACTATCCCTCGGACCCCTCTGCTACATCATCCCTCTTGTCATCCAGCTCATCTTTGA
ATCATTTGCCGCCGTGGGACAGCACTGGGGGGATGGTCTTTGCAAGTACATGCGCCCCTCTCTCATTTTAGCCTC
TGTTTAGCATTAGCAAGAAGTCAAAATCTGCTCCGCCGGGACGGAGAGCCGCTCATCCAGTCAGTGGCCGCGCCC
TCAACCGCCCAACGGTTCGATAAGATCTAAAACGTACCTTGCCTGCCCTGCCACGGTCGTCTCCGGAGCCACGAC
AACCCTGTCAGCGTCAAACCTTCTCTCTTACCTTACTCTACCTGCATCGCCTGGACAGATCATCAACCAGGCTGA
AGTATCTCAACCAACCCAGCAACATCATCCATCTATCCACAATCACCCTCAATTACTGCCCGCCTGCTTGTCCCT
GAGCCGGACTCCACTGTTCATCATCTAGTCTCGTTAGCGCGTCTGGTTGAGGTGGGTGATAACCTCGCCGGTGAC
TTGAACCCGCAACTAGCCGCATCGCTCCTGACCTTTCCCCCTCAGGTATGCCTGCCTCTCTCTCCATAGACCAAC
CAGCCTCCTGACGACCACTTTGCTCAATGAATAATATCTTGTTCATATCCGTCTCCTTGTCACTAACCAACTAAA
CGTTAGCCGGGAATTCACCTCCGTGCGACTCGCCGCAGGGCACTGACGTTATCAATTGCGGTCCCGGCCTTGGCC
GCTGGACGAAATGGCACTGCCCACCATGGGGAGCGACTTTCAGCTATTCTCTCCCCTCCAGTCGTCGGATAGAAG
AGACTCACAGGCCGAGTCTACGACCTTCGCTCAGTCTACAACGGAAGATTCCAGTCAGGATTGGACGCAGTGGAT
GAGATGGGATGACAAGGGCTTTGCGGATGGGGCAAAAGACGTCTCTCACTCCCCCTTCGATACTACCTTCACCTC
GCCCAATGCGTCAATTGGCAACACAGATCTCTTTCAAAAGTCCGACTTCTCACCCGACATCAACCTGGATTGTAC
CAATATTCCCTTTGATTCCTTGCTCGATCAAAATTACAGTGGCGTGTGCCAATCGAAGATCGGATCCATTGGTAC
CGATCTCCAGTCGGCACTCTCCGCTACGTCCGGCTCTCCGTTATCCTCGGAAGGAACTGCTCGCAAACGCAAGTC
GGGCAGTGATGATGATGGCTCAACCGTCAGTGGAGTCATGCCGACCGGTAAGAAGATGCCGGCCAAAAAGCGAGC
ACACAACGTCATCGAGAAGAGGTATCGAGCCAACCTTAATGAGAAGATTGCCGAGCTGAGGGACAGTGTGCCCAG
TCTCCGAGCGTCAAAAAATGCGTCGGGTAATCTCCTGGAAGATGACGATGGAGAAGGGGTCACTCCCGCCAACAA
GTTGAACAAGGCCTCTATTCTCTCAAAAGCCACAGAGTATATTCGTCACCTTGAGATCCGTAATAAGCGACTTGA
GGATGAGAACATGGCATTGAAGAACCGACTTCGTCAAGCGGAAAAGGCCGTTGACCAGTCACTGACCTCCGCAGC
GTCCGTTTCCTCACCCAGCAACTACACCGTTTCCACAGAATCTGGCGCAAGCTCATCCCCCAGTGTGTTCTCACA
TGTGGAGGATAGTCCTAGCGACCACTCGCCGACGTCTTTGTATCCTCCCGAAGGTCTGCTGAAGGTGCCCGATGC
CTTCAAACGCATGCGAGAGGAATCCACCGCTAAAGATAACGCGTTCTCTCAATCATACATCCAATACCCCAGCAG
CAATAACAGTGTCTCATCCCCATGCGGTGGTCGTACCAGGCGATCATATTACCCCAACAAGTACATGCTTGGTGC
CCTTGCTGGCTTAATGATCGTCGAGGGTATGGGCAGCGAAAAGAACACGGAATCAACCGCCAAGGGGCTGCTGGC
AATGCCATTCAACCTGTTCGGAAACTTGCAAACCAGCCTCCAAAGTCCCACAGCAGCATACTGGTTTGCAATGGC
ACGAAACTTTTGGTATTCGTGGCATGCACGAGCCATCTCGCATTTTCTTATTCTCGCTACCCTTGTCGTCGGTAG
TGCATTCGTGGTCTTCGTTTATTTGTTCAACGCTACCCCCGGCGAACAGTCCTCTTCATTGAAGACTTCGTCACC
ATCGGATACATCGTCAAATTTCCGGCGCCAGGCCTGGCTGACGAGCATACAGCGAGTCGGTGTTCCACGTCACCG
CTTTTTCCACGAGTGGTACGTAGTGACCTCGCGCTGCTTCGAGTATGTCCTGCGGTGTCTCCTGGGCTGGAAACT
GTACTCTTCTCTTACAGGAGTTACCGAGGAGGACGAGAAGGGGCGAGTCAAGACCTGGGATATTGCAATCGACGC
ACAATTGGCTGGTGGTGATGCCGAAATTAGTAAGAGTCGTCTAGTCCTGACTATCTTTGCGGCAGGCACCCTGCC
TCGGAGTCCTATGAGGATGATGCTCAAAGCCCTCCACTGCCGCATTCTGCTCTGGAGAGTTGGGGACCGCGGCTC
TTGGAGCTTCGACTTGTCGAATGATGTCGCTCGTTCACTGGCAAGGTATCAATGGGACCTCGCCCGGAAAATGCA
CAAGGCTATGCCGAAAGACCATCCTGATGCCCTGCCTAGTCATCTGGCTGCGTTGTTACAACTGGACTGCGACGA
GGTCATGATTGACAGCATCGTGCAAAGAGCGGCAAACCTCACTTGGAATCGTCCCACTCAAGAAGGTACCGATGA
TGATCAAGCTCTCCTGGATGTGGTGGAAGAGGACCCTGCCATTCAATCTTCCCTGGATGCCCTTGCGGCTTGGTG
GTCTAGCCATCTTTTGCAACGGGCGCTGCTGAGATATTTCGAAGCTAGCTCCGGTGGGCCTGACGCAAAGAAGAG
TCGCGATCTATTCAAGGCTAAGATTAAATTGGCCCTGGACGTCGCTCCCCAGCCTTCAGCCGCTCATACTCGAGC
TTTGGTGATGAAGGCAGTATTCTTCGAGCAAGACCGCGCTGCGAATATCGGATCCGTCCTTGCGGCATTGCCGAA
AGACAAAGGGAAGAGCAAACAAAACCAAGCATCCAACTTCCTTGACTCGTCTCTTCCCGTGTCTGTGCGGGAAGA
GATCGCGATATCAGTTCGCTGTGCAATGATTGCGGCCATTTTTACCGCTAGGACTACAGGCGACACCTCTCTACC
GGCGTCCTTTACCATCCAAAGAGCTGTTACGTGGTTCAATCAGTTGCCGCTTGACCCGGTGGATCTGACGCTTCT
TGGGTTTGCGTCTGTGTACCATTTGCTCCATGTCTTAGCTTCTGACACCGACTATCTGTCGTCTTCCGAGTCCTC
ATCGCCATCTTCGCCTGTATCGCGCAGCTCCACCCCGTCGTCTTCGGTTTCCTCTGACGAAGAGGGGAATGACAA
GCCACGCCTGTCGCAGAAGCCCGAGATTTTGCCGCAATCCATTCCGAATTTGGGTCGTGTAGCATCCGAACTCAT
GTACTGGGCGCGGAATGCATACAATCCTGCTTTCTACGGTTTCACTTCTCAACTTGTCAAGGTCATCGAAACCGA
ATGCACCTCGCTATGCCATAGTGCCGGGGTCGACGTGGCCGACTACTCTTGTATCCAGGAGGAGAAGATCAAGTC
GAAACAATTAAAAGACAAAAAGAAGAAAAAGTACCCGAGAAGGTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail