Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g6556.t1
Gene name
Locationscaffold_049:154060..156982
Strand+
Gene length (bp)2922
Transcript length (bp)2316
Coding sequence length (bp)2316
Protein length (aa) 772

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 8.1E-173 78 729

GO

GO Term Description Terminal node
GO:0035673 oligopeptide transmembrane transporter activity Yes
GO:0005215 transporter activity No
GO:1904680 peptide transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0022857 transmembrane transporter activity No
GO:0042887 amide transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

Domain # Start End Length
1 80 102 22
2 107 129 22
3 192 214 22
4 261 283 22
5 329 351 22
6 398 420 22
7 449 471 22
8 481 503 22
9 524 546 22
10 561 583 22
11 628 650 22
12 674 696 22
13 709 731 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g6556.t1
MARYISETSHDADVEEYAGDPTLHNDGIFKKPVATADALDIALGESSNVEYTIESDNSPYLEVRANVPNTDDPTL
PVNTFRMWFLGVVFTLLGTGVNQFFSMRYPSVTITSLVAQLLSYPVGCFFAKALPIMKVRLFGRWDLDINPDHHF
NIKEHAVITIMSNLSFNQSWASAIIQAQKVYLKMSTPVGYQILLSLSMQLFGLGLAGLSYRYIIEPPQMIWPSTL
ANAALFQTLHSGANPIADGWKISRYRFFLFVCIGSFCWYWFPGYIFTGLSTFAFICWAAPNNKVVNNLFGMTTGL
GYMPTTFDWSQIAYNTSPLTIPYWAQANVFAGWFLIYAVAAPILYYTNTWYTAYLPLTSSDAYDNTGSVYDSSRI
LNSEGVFDEDKYKAYSPLFLPVTFSLSYGVGFAVLTCLITHVLLYHTKDIIKTFRGESKKDIHARLLSQYPDVPW
WWYGALTVIIVALAIMTQYVWHTGLPFWGLFITLALAAIYVIPVGTVYAVANLNSNCLTVLGEIVSGYLLKGKPL
VLLIFKFYAYTGLSQAMYYGADMKLGMYMKIPRQTLFVAQLIACILGTLTQNGVLLWMLGNVQDVCSDDQSDNFT
CPQGRVNYNSAVLWGAIGPTRLYNIGKIYSGLLHFFWIGALLPIITFALRKKFPKSRFLDAIHWPIFFAGTGNLP
PATGINYSTAFVVSLIFNKIIKGRKPHWWAKYNYVLSAALDSGVAVGAIVIFFALTFPGITFNWWGNTVNSGTVD
SKGTPWLELKGNQTFGPATWS*
Coding >Ani_SJS72_1|g6556.t1
ATGGCTCGTTATATATCAGAGACCTCGCATGATGCAGATGTCGAGGAATATGCGGGGGATCCTACGCTCCACAAC
GATGGTATTTTTAAGAAGCCTGTGGCCACTGCAGACGCCCTAGACATTGCCCTTGGCGAAAGCAGCAATGTTGAG
TATACCATCGAATCGGACAATTCTCCTTACCTGGAAGTGCGAGCCAATGTGCCGAACACGGATGACCCTACTTTG
CCCGTCAACACATTTCGAATGTGGTTTCTGGGAGTTGTCTTCACGCTCCTTGGCACAGGCGTCAATCAGTTCTTT
TCTATGCGGTATCCCAGTGTGACAATTACTTCGTTGGTGGCGCAGCTTCTTAGTTACCCCGTGGGATGTTTCTTT
GCCAAAGCCCTGCCCATCATGAAGGTGCGCTTGTTTGGGCGCTGGGACTTGGACATAAACCCGGATCACCACTTC
AATATCAAGGAGCACGCTGTGATTACGATCATGTCTAATCTCAGCTTCAACCAGTCTTGGGCAAGTGCTATCATT
CAGGCGCAAAAGGTGTATCTCAAGATGTCAACGCCTGTAGGATATCAGATTCTGCTATCTCTGTCAATGCAGTTG
TTTGGTCTTGGGCTTGCTGGCTTGTCATACAGATACATCATCGAGCCGCCTCAGATGATTTGGCCTTCTACACTG
GCAAACGCAGCCCTCTTTCAGACACTGCACAGTGGTGCAAACCCCATTGCAGACGGTTGGAAGATCTCGCGATAT
CGGTTCTTCCTGTTCGTTTGCATTGGAAGCTTCTGCTGGTATTGGTTCCCTGGCTATATTTTTACTGGTCTCAGT
ACTTTTGCCTTCATTTGCTGGGCAGCTCCTAACAATAAGGTCGTCAACAACCTCTTCGGTATGACCACGGGTCTG
GGATATATGCCCACGACGTTCGATTGGAGCCAGATTGCGTATAACACATCACCCTTGACCATCCCGTACTGGGCA
CAGGCCAATGTCTTTGCCGGCTGGTTTTTGATATATGCTGTGGCGGCCCCAATCCTTTACTATACCAACACGTGG
TACACAGCATATCTCCCACTCACAAGCTCCGATGCATATGACAATACGGGAAGTGTCTACGACTCGAGTCGCATC
TTGAACAGCGAAGGAGTCTTCGATGAGGACAAGTATAAAGCGTATAGCCCCCTTTTCTTGCCAGTAACCTTCTCC
TTGAGTTACGGAGTAGGATTTGCAGTCCTGACTTGTTTGATTACGCACGTACTACTCTATCATACGAAAGATATC
ATCAAAACGTTTCGAGGGGAGAGCAAAAAGGATATTCACGCCAGGCTGCTTTCTCAGTATCCTGACGTACCGTGG
TGGTGGTACGGTGCCTTGACTGTTATTATCGTTGCGCTTGCGATCATGACACAGTATGTATGGCATACGGGGCTT
CCGTTCTGGGGATTGTTTATCACGTTGGCCCTGGCTGCCATTTATGTCATCCCCGTTGGAACAGTATATGCTGTG
GCAAACCTTAACAGCAACTGTCTGACCGTTCTGGGAGAGATCGTATCCGGCTATCTGCTGAAAGGGAAGCCGCTC
GTTCTTTTGATATTCAAGTTTTATGCATACACTGGGCTAAGTCAAGCCATGTATTACGGCGCAGACATGAAGCTT
GGAATGTACATGAAGATTCCTCGACAGACTCTGTTCGTTGCCCAGCTGATTGCCTGCATCCTGGGGACATTGACG
CAGAACGGGGTCCTGCTCTGGATGCTTGGAAATGTGCAAGACGTATGCTCGGATGACCAATCGGACAACTTTACT
TGCCCGCAGGGTCGGGTCAACTATAATAGTGCCGTTCTTTGGGGAGCTATTGGACCCACCAGGCTATACAATATC
GGAAAGATATATTCCGGTCTTCTGCACTTTTTCTGGATCGGAGCGTTGCTTCCTATTATCACCTTTGCCTTGCGC
AAGAAATTCCCGAAGTCTCGGTTCCTGGATGCCATCCATTGGCCGATTTTCTTTGCTGGCACGGGTAACCTACCT
CCTGCTACGGGTATCAACTACTCCACAGCGTTTGTAGTCAGTCTTATTTTCAACAAGATCATCAAAGGTCGCAAG
CCGCACTGGTGGGCTAAGTACAACTACGTGCTGTCTGCAGCACTGGATTCAGGGGTTGCCGTCGGAGCCATAGTG
ATCTTCTTCGCGCTGACATTCCCGGGGATTACCTTCAACTGGTGGGGTAACACGGTCAATAGTGGGACTGTGGAT
AGCAAGGGCACGCCGTGGCTGGAGCTGAAGGGAAATCAGACCTTTGGACCGGCGACATGGTCTTGA
Transcript >Ani_SJS72_1|g6556.t1
ATGGCTCGTTATATATCAGAGACCTCGCATGATGCAGATGTCGAGGAATATGCGGGGGATCCTACGCTCCACAAC
GATGGTATTTTTAAGAAGCCTGTGGCCACTGCAGACGCCCTAGACATTGCCCTTGGCGAAAGCAGCAATGTTGAG
TATACCATCGAATCGGACAATTCTCCTTACCTGGAAGTGCGAGCCAATGTGCCGAACACGGATGACCCTACTTTG
CCCGTCAACACATTTCGAATGTGGTTTCTGGGAGTTGTCTTCACGCTCCTTGGCACAGGCGTCAATCAGTTCTTT
TCTATGCGGTATCCCAGTGTGACAATTACTTCGTTGGTGGCGCAGCTTCTTAGTTACCCCGTGGGATGTTTCTTT
GCCAAAGCCCTGCCCATCATGAAGGTGCGCTTGTTTGGGCGCTGGGACTTGGACATAAACCCGGATCACCACTTC
AATATCAAGGAGCACGCTGTGATTACGATCATGTCTAATCTCAGCTTCAACCAGTCTTGGGCAAGTGCTATCATT
CAGGCGCAAAAGGTGTATCTCAAGATGTCAACGCCTGTAGGATATCAGATTCTGCTATCTCTGTCAATGCAGTTG
TTTGGTCTTGGGCTTGCTGGCTTGTCATACAGATACATCATCGAGCCGCCTCAGATGATTTGGCCTTCTACACTG
GCAAACGCAGCCCTCTTTCAGACACTGCACAGTGGTGCAAACCCCATTGCAGACGGTTGGAAGATCTCGCGATAT
CGGTTCTTCCTGTTCGTTTGCATTGGAAGCTTCTGCTGGTATTGGTTCCCTGGCTATATTTTTACTGGTCTCAGT
ACTTTTGCCTTCATTTGCTGGGCAGCTCCTAACAATAAGGTCGTCAACAACCTCTTCGGTATGACCACGGGTCTG
GGATATATGCCCACGACGTTCGATTGGAGCCAGATTGCGTATAACACATCACCCTTGACCATCCCGTACTGGGCA
CAGGCCAATGTCTTTGCCGGCTGGTTTTTGATATATGCTGTGGCGGCCCCAATCCTTTACTATACCAACACGTGG
TACACAGCATATCTCCCACTCACAAGCTCCGATGCATATGACAATACGGGAAGTGTCTACGACTCGAGTCGCATC
TTGAACAGCGAAGGAGTCTTCGATGAGGACAAGTATAAAGCGTATAGCCCCCTTTTCTTGCCAGTAACCTTCTCC
TTGAGTTACGGAGTAGGATTTGCAGTCCTGACTTGTTTGATTACGCACGTACTACTCTATCATACGAAAGATATC
ATCAAAACGTTTCGAGGGGAGAGCAAAAAGGATATTCACGCCAGGCTGCTTTCTCAGTATCCTGACGTACCGTGG
TGGTGGTACGGTGCCTTGACTGTTATTATCGTTGCGCTTGCGATCATGACACAGTATGTATGGCATACGGGGCTT
CCGTTCTGGGGATTGTTTATCACGTTGGCCCTGGCTGCCATTTATGTCATCCCCGTTGGAACAGTATATGCTGTG
GCAAACCTTAACAGCAACTGTCTGACCGTTCTGGGAGAGATCGTATCCGGCTATCTGCTGAAAGGGAAGCCGCTC
GTTCTTTTGATATTCAAGTTTTATGCATACACTGGGCTAAGTCAAGCCATGTATTACGGCGCAGACATGAAGCTT
GGAATGTACATGAAGATTCCTCGACAGACTCTGTTCGTTGCCCAGCTGATTGCCTGCATCCTGGGGACATTGACG
CAGAACGGGGTCCTGCTCTGGATGCTTGGAAATGTGCAAGACGTATGCTCGGATGACCAATCGGACAACTTTACT
TGCCCGCAGGGTCGGGTCAACTATAATAGTGCCGTTCTTTGGGGAGCTATTGGACCCACCAGGCTATACAATATC
GGAAAGATATATTCCGGTCTTCTGCACTTTTTCTGGATCGGAGCGTTGCTTCCTATTATCACCTTTGCCTTGCGC
AAGAAATTCCCGAAGTCTCGGTTCCTGGATGCCATCCATTGGCCGATTTTCTTTGCTGGCACGGGTAACCTACCT
CCTGCTACGGGTATCAACTACTCCACAGCGTTTGTAGTCAGTCTTATTTTCAACAAGATCATCAAAGGTCGCAAG
CCGCACTGGTGGGCTAAGTACAACTACGTGCTGTCTGCAGCACTGGATTCAGGGGTTGCCGTCGGAGCCATAGTG
ATCTTCTTCGCGCTGACATTCCCGGGGATTACCTTCAACTGGTGGGGTAACACGGTCAATAGTGGGACTGTGGAT
AGCAAGGGCACGCCGTGGCTGGAGCTGAAGGGAAATCAGACCTTTGGACCGGCGACATGGTCTTGA
Gene >Ani_SJS72_1|g6556.t1
ATGGCTCGTTATATATCAGAGACCTCGCATGATGCAGATGTCGAGGAATATGCGGGGGATCCTACGCTCCACAAC
GATGGTATTTTTAAGAAGCCTGTGGCCACTGCAGACGCCCTAGACATTGCCCTTGGCGAAAGCAGCAATGTTGAG
TATACCATCGAATCGGACAATTCTCCTTACCTGGAAGTGCGAGCCAATGTGCCGAACACGGATGACCCTACTTTG
CCCGTCAACACATTTCGAATGTGGTTTCTGGGAGTTGTCTTCACGCTCGTGGGTACCCAGGAGACATATAATCGT
ATCAAGACACTGACATTCTTCAAAGCTTGGCACAGGCGTCAATCAGTTCTTTTCTATGCGGTATCCCAGTGTGAC
AATTACTTCGTTGGTGGCGCAGCTTCTTAGTTACCCCGTGGGATGTTTCTTTGCCAAAGCCCTGCCCATCATGAA
GGTGCGCTTGTTTGGGCGCTGGGACTTGGACATAAACCCGGATCACCACTTCAATATCAAGGAGCACGCTGTGAT
TACGATCATGTCTAATCTCAGCTTCAACCAGTCTTGGGTAAGCTCCTGTCAGCTAGGGAAGGGCTCAGTTGGATA
ACAATTACTGACATATGCGATAGGCAAGTGCTATCATTCAGGCGCAAAAGGTGTATCTCAAGATGTCAACGCCTG
TAGGATATCAGATTCTGCTATCTCTGTCAATGCAGTTGTTTGGTCTTGGGCTTGCTGGCTTGTCATACAGATACA
TCATCGAGCCGCCTCAGATGGTAAGCCTTGGCAGACAAACTTTGGGGAAGCTCTACACTAAACCAGCTTCGCTTA
GATTTGGCCTTCTACACTGGCAAACGCAGCCCTCTTTCAGACACTGCACAGTGGTGCAAACCCCATTGCAGACGG
TTGGAAGATCTCGCGATATCGGTTCTTCCTGTTCGTTTGCATTGGAAGCTTCTGCTGGTATTGGTTCCCTGGCTA
TATTTTTACTGGTCTCAGTACTTTTGCCTTCATTTGCTGGGCAGCTCCTAGTATGTTGGGATATACGTTGTCCCA
CAAAAAGGCATTCTCAGTTAACATGATATCTAGACAATAAGGTCGTCAACAACCTCTTCGGTATGACCACGGGTC
TGGGATATATGCCCACGACGTTCGATTGGAGCCAGATTGCGTATAACACATCACCCTTGACCATCCCGTACTGGG
CACAGGCCAATGTCTTTGCCGGCTGGTTTTTGATATATGCTGTGGCGGCCCCAATCCTTTACTATACCAACACGT
GGTACACAGCATATCTCCCACTCACAAGCTCCGATGCATATGACAATACGGGAAGTGTCTACGACTCGAGTCGCA
TCTTGAACAGCGAAGGAGTCTTCGATGAGGACAAGTATAAAGCGTATAGCCCCCTTTTCTTGCCAGTAACCTTCT
CCTTGAGTTACGGAGTAGGATTTGCAGTCCTGACTTGTTTGATTACGCACGTACTACTCTATCATACGAAAGATA
TCATCAAAACGTTTCGAGGGGAGAGCAAAAAGGATATTCACGCCAGGCTGCTTTCTCAGTATCCTGACGTACCGT
GGTGGTGGTACGGTGCCTTGACTGTAAGCATTACTTCCTTCTAATTTGAACAAGCTAACAGTAAAGGTTATTATC
GTTGCGCTTGCGATCATGACACAGTATGTATGGCATACGGGGCTTCCGTTCTGGGGATTGTTTATCACGTTGGCC
CTGGCTGCCATTTATGTCATCCCCGTTGGAACAGTATATGCTGTGGCAAACCTTAACAGCAACTGTCTGACCGTT
CTGGGAGAGATCGTATCCGGCTATCTGCTGAAAGGGAAGCCGCTCGTTCTTTTGATATTCAAGGTGGGATTCCAA
GTTAAGACATCTCATCTGCAAAGTCTTCATTGACAGAAACGATAGTTTTATGCATACACTGGGCTAAGTCAAGCC
ATGTATTACGGCGCAGACATGAAGGTTGGTGGATTGTGCGAACCTGATAAAGAAGCGTCTGTACTAATGCATAAT
ATCCAGCTTGGAATGTACATGAAGATTCCTCGACAGACTCTGTTCGTTGCCCAGCTGATTGCCTGCATCCTGGGG
ACATTGACGCAGAGTGAGTGACGGCTGTATACCCGCTTTTTTGGCTGCTGGCCGCTGACCAGGACAGACGGGGTC
CTGCTCTGGATGCTTGGAAATGTGCAAGACGTATGCTCGGATGACCAATCGGACAACTTTACTTGCCCGCAGGGT
CGGGTCAACTATAATAGTGCCGTTCTTTGGGGAGGTATGGCTTCTGTCGCTCCTCTTGGCCTGCACAAGGATCTC
ACTGACGATGCTACAGCTATTGGACCCACCAGGCTATACAATATCGGAAAGATATATTCCGGTCTTCTGCACTTT
TTCTGGATCGGAGCGTTGCTTCCTATTATCACCTTTGCCTTGCGCAAGAAATTCCCGAAGTCTCGGTTCCTGGAT
GCCATCCATTGGCCGATTTTCTTTGCTGGCACGGGTAACCTACCTCCTGCTGTACGGATTCCCCCCTTTGTCAAG
GGTGATTATCCAAGCTAACTGATAGCGGTAGACGGGTATCAACTACTCCACAGCGTTTGTAGTCAGTCTTATTTT
CAACAAGGTGAGTCATCTATCATTTAACATTACGACCCAGAGCGACACTCTAAACAGTTACAGATCATCAAAGGT
CGCAAGCCGCACTGGTGGGCTAAGTACAACTACGTGCTGTCTGCAGCACTGGATTCAGGGGTTGCCGTCGGAGCC
ATAGTGATCTTCTTCGCGCTGACATTCCCGGGGATTACCTTCAACTGGTGGGGTAACACGGTCAATAGTGGGACT
GTGGATAGCAAGGGCACGCCGTGGCTGGAGCTGAAGGGAAATCAGACCTTTGGACCGGCGACATGGTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail