Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g6477.t1
Gene name
Locationscaffold_048:197270..198422
Strand-
Gene length (bp)1152
Transcript length (bp)1152
Coding sequence length (bp)1152
Protein length (aa) 384

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03403 PAF-AH_p_II Platelet-activating factor acetylhydrolase, isoform II 4.7E-08 116 155
PF03403 PAF-AH_p_II Platelet-activating factor acetylhydrolase, isoform II 4.6E-06 220 320
PF12740 Chlorophyllase2 Chlorophyllase enzyme 2.4E-08 116 242

GO

GO Term Description Terminal node
GO:0016042 lipid catabolic process Yes
GO:0003847 1-alkyl-2-acetylglycerophosphocholine esterase activity Yes
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0052689 carboxylic ester hydrolase activity No
GO:0003674 molecular_function No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901575 organic substance catabolic process No
GO:0016787 hydrolase activity No
GO:0009056 catabolic process No
GO:0006629 lipid metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g6477.t1
MIRLLLHTVIFLFVGLSRAAIVPLPPSTGPCDVTLQASELVDQARTNPFDSKGGKRALMVTTFTPVNCGSVLSEF
YIPNATAAYEDESFQSLGLAAGTFESFRIQTQQQPSPSIVNKSYPIVLFSPALGTSRLVYTSLLQDIASYGFAVI
SVDHPYDANIVEFPDGRTVIGVLENTTTDAQFTWAMNVRVQDMIFVYNQTRNETAVRDIFPLSLKNPHLLSLDRV
AITGHSLGGATAAQTMLVDNRFVGGINLDGTFWGSVLTKGLSSPFLLFSNANHTAATDPSWGTFWSNLRGWRLEL
RLAQSKHYTFSDFPVLLESLSISDELKEIVQASYIGTIGALRAKNVIVSYIVAALQYFAYGRTSDLLSGPSAAYP
DVTFVHSA*
Coding >Ani_SJS72_1|g6477.t1
ATGATTCGGCTTTTGCTACACACCGTTATTTTCCTATTTGTCGGCCTCAGTCGAGCAGCAATCGTCCCCCTTCCT
CCAAGCACCGGACCATGCGACGTCACGCTCCAGGCGAGTGAACTGGTCGATCAAGCTCGTACCAATCCATTCGAT
TCAAAAGGGGGTAAACGCGCTCTAATGGTCACGACCTTTACACCCGTCAATTGCGGAAGTGTGCTCTCTGAATTT
TACATACCGAATGCAACAGCAGCATACGAGGATGAGAGTTTCCAGTCTCTTGGACTAGCCGCAGGGACTTTCGAG
TCCTTTCGTATCCAGACACAGCAGCAGCCATCACCTTCAATTGTTAACAAAAGCTATCCAATTGTGCTCTTCTCA
CCAGCTCTGGGAACATCAAGATTGGTGTACACCTCGCTGCTTCAAGACATTGCCAGTTACGGATTTGCTGTCATT
TCCGTCGATCATCCATACGATGCCAACATTGTGGAATTTCCCGATGGCCGTACGGTTATCGGCGTTCTCGAAAAC
ACCACTACAGATGCGCAGTTCACTTGGGCTATGAACGTTCGCGTCCAAGACATGATATTTGTTTACAATCAGACT
CGCAATGAGACAGCAGTCAGAGACATATTCCCCTTGTCACTGAAAAATCCACATCTGCTATCTCTCGACCGAGTC
GCAATTACTGGCCATTCCCTTGGCGGAGCAACAGCAGCGCAGACAATGTTGGTTGACAACCGATTTGTCGGCGGT
ATCAATTTAGATGGTACATTCTGGGGATCTGTCCTCACTAAAGGACTGTCCAGCCCTTTTCTGCTTTTCAGTAAT
GCCAACCACACAGCGGCAACAGATCCTAGCTGGGGAACATTCTGGTCGAATTTACGAGGATGGAGATTGGAGCTA
CGACTCGCACAGTCTAAGCACTATACCTTTTCCGACTTTCCGGTGCTTCTCGAATCCCTGAGTATCTCTGACGAA
CTGAAAGAAATTGTCCAGGCCAGTTATATTGGGACGATTGGTGCTTTGCGCGCTAAGAACGTGATTGTCTCGTAC
ATCGTTGCTGCGTTGCAGTACTTTGCTTATGGGCGCACGTCAGATCTACTGAGTGGCCCTTCGGCAGCATATCCT
GATGTTACTTTTGTACATTCTGCCTAG
Transcript >Ani_SJS72_1|g6477.t1
ATGATTCGGCTTTTGCTACACACCGTTATTTTCCTATTTGTCGGCCTCAGTCGAGCAGCAATCGTCCCCCTTCCT
CCAAGCACCGGACCATGCGACGTCACGCTCCAGGCGAGTGAACTGGTCGATCAAGCTCGTACCAATCCATTCGAT
TCAAAAGGGGGTAAACGCGCTCTAATGGTCACGACCTTTACACCCGTCAATTGCGGAAGTGTGCTCTCTGAATTT
TACATACCGAATGCAACAGCAGCATACGAGGATGAGAGTTTCCAGTCTCTTGGACTAGCCGCAGGGACTTTCGAG
TCCTTTCGTATCCAGACACAGCAGCAGCCATCACCTTCAATTGTTAACAAAAGCTATCCAATTGTGCTCTTCTCA
CCAGCTCTGGGAACATCAAGATTGGTGTACACCTCGCTGCTTCAAGACATTGCCAGTTACGGATTTGCTGTCATT
TCCGTCGATCATCCATACGATGCCAACATTGTGGAATTTCCCGATGGCCGTACGGTTATCGGCGTTCTCGAAAAC
ACCACTACAGATGCGCAGTTCACTTGGGCTATGAACGTTCGCGTCCAAGACATGATATTTGTTTACAATCAGACT
CGCAATGAGACAGCAGTCAGAGACATATTCCCCTTGTCACTGAAAAATCCACATCTGCTATCTCTCGACCGAGTC
GCAATTACTGGCCATTCCCTTGGCGGAGCAACAGCAGCGCAGACAATGTTGGTTGACAACCGATTTGTCGGCGGT
ATCAATTTAGATGGTACATTCTGGGGATCTGTCCTCACTAAAGGACTGTCCAGCCCTTTTCTGCTTTTCAGTAAT
GCCAACCACACAGCGGCAACAGATCCTAGCTGGGGAACATTCTGGTCGAATTTACGAGGATGGAGATTGGAGCTA
CGACTCGCACAGTCTAAGCACTATACCTTTTCCGACTTTCCGGTGCTTCTCGAATCCCTGAGTATCTCTGACGAA
CTGAAAGAAATTGTCCAGGCCAGTTATATTGGGACGATTGGTGCTTTGCGCGCTAAGAACGTGATTGTCTCGTAC
ATCGTTGCTGCGTTGCAGTACTTTGCTTATGGGCGCACGTCAGATCTACTGAGTGGCCCTTCGGCAGCATATCCT
GATGTTACTTTTGTACATTCTGCCTAG
Gene >Ani_SJS72_1|g6477.t1
ATGATTCGGCTTTTGCTACACACCGTTATTTTCCTATTTGTCGGCCTCAGTCGAGCAGCAATCGTCCCCCTTCCT
CCAAGCACCGGACCATGCGACGTCACGCTCCAGGCGAGTGAACTGGTCGATCAAGCTCGTACCAATCCATTCGAT
TCAAAAGGGGGTAAACGCGCTCTAATGGTCACGACCTTTACACCCGTCAATTGCGGAAGTGTGCTCTCTGAATTT
TACATACCGAATGCAACAGCAGCATACGAGGATGAGAGTTTCCAGTCTCTTGGACTAGCCGCAGGGACTTTCGAG
TCCTTTCGTATCCAGACACAGCAGCAGCCATCACCTTCAATTGTTAACAAAAGCTATCCAATTGTGCTCTTCTCA
CCAGCTCTGGGAACATCAAGATTGGTGTACACCTCGCTGCTTCAAGACATTGCCAGTTACGGATTTGCTGTCATT
TCCGTCGATCATCCATACGATGCCAACATTGTGGAATTTCCCGATGGCCGTACGGTTATCGGCGTTCTCGAAAAC
ACCACTACAGATGCGCAGTTCACTTGGGCTATGAACGTTCGCGTCCAAGACATGATATTTGTTTACAATCAGACT
CGCAATGAGACAGCAGTCAGAGACATATTCCCCTTGTCACTGAAAAATCCACATCTGCTATCTCTCGACCGAGTC
GCAATTACTGGCCATTCCCTTGGCGGAGCAACAGCAGCGCAGACAATGTTGGTTGACAACCGATTTGTCGGCGGT
ATCAATTTAGATGGTACATTCTGGGGATCTGTCCTCACTAAAGGACTGTCCAGCCCTTTTCTGCTTTTCAGTAAT
GCCAACCACACAGCGGCAACAGATCCTAGCTGGGGAACATTCTGGTCGAATTTACGAGGATGGAGATTGGAGCTA
CGACTCGCACAGTCTAAGCACTATACCTTTTCCGACTTTCCGGTGCTTCTCGAATCCCTGAGTATCTCTGACGAA
CTGAAAGAAATTGTCCAGGCCAGTTATATTGGGACGATTGGTGCTTTGCGCGCTAAGAACGTGATTGTCTCGTAC
ATCGTTGCTGCGTTGCAGTACTTTGCTTATGGGCGCACGTCAGATCTACTGAGTGGCCCTTCGGCAGCATATCCT
GATGTTACTTTTGTACATTCTGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail