Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g6452.t1
Gene name
Locationscaffold_048:114177..115137
Strand+
Gene length (bp)960
Transcript length (bp)852
Coding sequence length (bp)852
Protein length (aa) 284

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 1.2E-43 5 189
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 6.8E-31 14 189
PF08659 KR KR domain 2.1E-10 6 169
PF08643 DUF1776 Fungal family of unknown function (DUF1776) 6.1E-07 5 263
PF13460 NAD_binding_10 NAD(P)H-binding 5.6E-07 16 91
PF01370 Epimerase NAD dependent epimerase/dehydratase family 3.0E-06 8 212

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g6452.t1
MAPLQTVLITGCSANGIGSALAVALANQGHHVFATARSPSKIPSSLTTLSNVTPLQLDVTSSESVAAAVQAVEQH
GTGLDILINNAGSGYTMPLLDVDLTQAQQVYETNIWGPLRLVQALAPLLISRGGRVVNISSVGAVVPTPWIGIYS
SSKSALSNLSETLRLEVAPLGVSVATLMIGTVTTPFHANEPRFTLPPNSRYAAIAETISRWASGEASPKGCSAQE
LADLILPDVLGTTGHGMFWRGPNSGAVKFVAQWVPGWLADRMMSTGQGLDELAASQSK*
Coding >Ani_SJS72_1|g6452.t1
ATGGCGCCCCTCCAGACTGTCTTGATCACCGGCTGCTCCGCCAACGGCATCGGATCGGCCCTGGCCGTCGCGCTC
GCCAATCAAGGCCACCACGTCTTCGCCACTGCGCGCTCACCATCCAAGATTCCGTCGTCTCTCACCACTTTGTCC
AATGTCACCCCTCTCCAGCTCGACGTCACGTCATCAGAGTCTGTGGCTGCTGCCGTTCAGGCAGTCGAGCAGCAT
GGAACAGGCCTAGATATTCTCATCAACAATGCGGGCTCCGGTTACACCATGCCGCTGCTGGACGTCGACCTCACC
CAAGCCCAGCAGGTCTACGAGACCAACATCTGGGGTCCGCTGCGTCTCGTTCAAGCACTAGCACCATTGCTAATA
TCCCGTGGTGGACGCGTCGTCAACATAAGCAGCGTCGGCGCGGTAGTCCCCACACCATGGATCGGAATCTACTCA
TCATCAAAATCCGCCTTGAGCAATCTCTCTGAGACCCTCCGTCTCGAAGTAGCACCACTAGGTGTATCCGTGGCC
ACGCTCATGATCGGCACCGTCACGACGCCGTTTCATGCAAACGAGCCCCGATTCACCCTCCCACCAAACTCTCGA
TATGCAGCTATCGCGGAGACCATCTCCCGCTGGGCGTCAGGTGAGGCAAGTCCCAAGGGATGCTCAGCCCAAGAG
CTGGCGGATTTGATCCTGCCTGATGTACTTGGTACGACGGGACATGGCATGTTCTGGCGCGGGCCGAATAGTGGT
GCGGTGAAATTTGTTGCTCAATGGGTGCCTGGGTGGTTAGCTGATCGCATGATGAGCACTGGTCAGGGATTGGAT
GAGCTCGCGGCGAGTCAGTCAAAGTGA
Transcript >Ani_SJS72_1|g6452.t1
ATGGCGCCCCTCCAGACTGTCTTGATCACCGGCTGCTCCGCCAACGGCATCGGATCGGCCCTGGCCGTCGCGCTC
GCCAATCAAGGCCACCACGTCTTCGCCACTGCGCGCTCACCATCCAAGATTCCGTCGTCTCTCACCACTTTGTCC
AATGTCACCCCTCTCCAGCTCGACGTCACGTCATCAGAGTCTGTGGCTGCTGCCGTTCAGGCAGTCGAGCAGCAT
GGAACAGGCCTAGATATTCTCATCAACAATGCGGGCTCCGGTTACACCATGCCGCTGCTGGACGTCGACCTCACC
CAAGCCCAGCAGGTCTACGAGACCAACATCTGGGGTCCGCTGCGTCTCGTTCAAGCACTAGCACCATTGCTAATA
TCCCGTGGTGGACGCGTCGTCAACATAAGCAGCGTCGGCGCGGTAGTCCCCACACCATGGATCGGAATCTACTCA
TCATCAAAATCCGCCTTGAGCAATCTCTCTGAGACCCTCCGTCTCGAAGTAGCACCACTAGGTGTATCCGTGGCC
ACGCTCATGATCGGCACCGTCACGACGCCGTTTCATGCAAACGAGCCCCGATTCACCCTCCCACCAAACTCTCGA
TATGCAGCTATCGCGGAGACCATCTCCCGCTGGGCGTCAGGTGAGGCAAGTCCCAAGGGATGCTCAGCCCAAGAG
CTGGCGGATTTGATCCTGCCTGATGTACTTGGTACGACGGGACATGGCATGTTCTGGCGCGGGCCGAATAGTGGT
GCGGTGAAATTTGTTGCTCAATGGGTGCCTGGGTGGTTAGCTGATCGCATGATGAGCACTGGTCAGGGATTGGAT
GAGCTCGCGGCGAGTCAGTCAAAGTGA
Gene >Ani_SJS72_1|g6452.t1
ATGGCGCCCCTCCAGACTGTCTTGATCACCGGCTGCTCCGCCAACGGCATCGGATCGGCCCTGGCCGTCGCGCTC
GCCAATCAAGGCCACCACGTCTTCGCCACTGCGCGCTCACCATCCAAGATTCCGTCGTCTCTCACCACTTTGTCC
AATGTCACCCCTCTCCAGCTCGACGTCACGTCATCAGAGTCTGTGGCTGCTGCCGTTCAGGCAGTCGAGCAGCAT
GGAACAGGCCTAGATATTCTCATCAACAATGCGGGCTCCGGTTACACCATGCCGCTGCTGGACGTCGACCTCACC
CAAGCCCAGCAGGTCTACGAGACCAACATCTGGGGTCCGCTGCGTCTCGTTCAAGCACTAGCACCATTGCTAATA
TCCCGTGGTGGACGCGTCGTCAACATAAGCAGCGTCGGCGCGGTAGTCCCCACACCATGGATCGGTACATCAGTC
CTCTCCCTCTCGGTCGGCATGCAGTGTCACATTAACAACGTGATACAGGAATCTACTCATCATCAAAATCCGCCT
TGAGCAATCTCTCTGAGACCCTCCGTCTCGAAGTAGCACCACTAGGTGTATCCGTGGCCACGCTCATGATCGGCA
CCGTCACGACGCCGTTTCATGCAAACGAGCCCCGATTCACCCTCCCACCAAACTCTCGATATGCAGCTATCGCGG
AGACCATCTCCCGCTGGGCGTCAGGTGAGGCAAGTCCCAAGGGATGCTCAGCCCAAGAGCTGGCGGATTTGATCC
TGCCTGATGTACTTGGTACGACGGGACATGGCATGTTCTGGCGCGGGCCGAATAGTGGTGCGGTGAAATTTGTTG
CTCAATGGGTGCCTGGGTGGTTAGCTGTGAGTTTGTCCTCTCCTACCGAGGGTATTATTGCTAATGTTGGAATAG
GATCGCATGATGAGCACTGGTCAGGGATTGGATGAGCTCGCGGCGAGTCAGTCAAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail