Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g6399.t1
Gene name
Locationscaffold_047:224496..226044
Strand-
Gene length (bp)1548
Transcript length (bp)1482
Coding sequence length (bp)1482
Protein length (aa) 494

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01593 Amino_oxidase Flavin containing amine oxidoreductase 3.0E-54 44 480
PF01266 DAO FAD dependent oxidoreductase 7.8E-11 36 407
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 4.7E-11 39 99
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 2.1E-06 35 88
PF01946 Thi4 Thi4 family 2.4E-07 35 77
PF00890 FAD_binding_2 FAD binding domain 2.0E-05 36 75

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g6399.t1
MSRSSEGYLWTPKQATSGLPTDAVHPSTPALRTHYDVIVIGAGFAGLIAARDLSRKHNLNVLLLEARDRIGGRTW
TAKVLGEEIEMGGTWVHWNQPHLYAELHRYGLHRNLKTSAGSFTPVDQWFKSSSGPVEKVSVGDYQATLERVAEK
FFAIDGLDSRALMPYPHDSLRGPAPWKRYDYLSVEERLEMSDLDGLSRWEKVLFASNVSTFGSAPVKDIGFVEAL
RWFALGGHSMAGVFELAGVYKLGSGGMTSFARAILGEFTGHVSFGTVVEQIDHGRDMVEVVTKDGRRVGARAVVS
TVPLNCLNDIQFQPPLTPLRQAAITKGHINKGAKIHFKLRETLPGWFFTAHDGSDSSFVFAFSDHNGTQLTGPSG
TWCIGFGYNDQLTNKKDSKYILQRFKHDVNPDVDIDAYATHDWMNDPYAKGAWACWGPNTASEYLEELQKPHGRV
VFASADWADGWRGFVDGAIERGQAAVGEVLGMLEGREGGRARL*
Coding >Ani_SJS72_1|g6399.t1
ATGTCCCGCTCCAGCGAAGGCTACCTCTGGACTCCCAAGCAAGCCACCTCAGGTCTACCCACAGACGCAGTCCAC
CCCAGCACGCCCGCCCTCCGCACCCACTACGACGTGATAGTCATCGGGGCCGGATTCGCCGGACTAATTGCAGCC
CGCGACCTAAGCAGGAAGCACAATCTCAACGTCCTGCTCCTAGAAGCGCGGGACCGCATCGGCGGTCGAACATGG
ACAGCCAAGGTCCTCGGCGAGGAGATCGAAATGGGCGGGACCTGGGTTCACTGGAACCAGCCGCATCTGTATGCC
GAGCTGCATCGGTACGGACTGCACCGGAATCTGAAGACCTCTGCGGGGTCATTCACGCCTGTGGATCAGTGGTTC
AAGTCCAGTAGTGGTCCTGTGGAGAAGGTTTCTGTTGGAGATTACCAGGCTACGCTTGAGCGCGTTGCAGAGAAG
TTTTTCGCAATTGATGGGCTGGACAGTCGTGCGTTGATGCCGTATCCGCATGATTCGCTGAGGGGGCCGGCGCCG
TGGAAGAGGTATGATTATCTTAGTGTGGAGGAGCGGTTGGAGATGTCGGATTTGGATGGGTTGTCGAGGTGGGAG
AAAGTGCTGTTTGCGTCTAATGTTAGTACGTTTGGGAGTGCGCCGGTGAAGGATATTGGATTTGTGGAGGCGCTG
CGGTGGTTTGCGCTGGGAGGGCATAGTATGGCTGGGGTGTTTGAGTTGGCGGGGGTGTACAAATTGGGGAGTGGA
GGGATGACTTCTTTTGCGAGGGCTATTTTGGGGGAGTTCACTGGTCATGTTAGCTTTGGAACGGTTGTTGAGCAG
ATTGATCATGGTCGTGATATGGTGGAGGTTGTCACTAAGGATGGGAGGAGGGTTGGGGCTCGTGCGGTGGTGTCG
ACGGTTCCGCTAAACTGCCTCAACGACATCCAATTTCAACCCCCACTCACCCCCCTCCGACAAGCAGCCATCACA
AAAGGCCACATTAACAAAGGCGCAAAGATCCACTTCAAGCTTCGCGAAACACTACCGGGTTGGTTCTTTACTGCA
CATGACGGCAGTGACTCCAGCTTTGTCTTTGCGTTCTCAGATCACAATGGAACCCAGCTAACAGGCCCGTCTGGC
ACCTGGTGCATTGGATTTGGGTACAACGATCAACTTACTAATAAGAAGGATAGCAAATATATCTTGCAGAGATTC
AAGCATGATGTTAACCCGGATGTGGATATTGATGCCTATGCCACCCATGATTGGATGAATGATCCGTATGCGAAA
GGGGCTTGGGCGTGCTGGGGACCAAATACTGCGTCAGAATACTTGGAGGAACTTCAGAAACCGCATGGACGGGTT
GTGTTTGCGAGCGCGGATTGGGCGGACGGGTGGAGGGGGTTTGTGGATGGTGCGATTGAGAGGGGACAGGCTGCT
GTGGGGGAGGTTTTGGGGATGCTGGAGGGGAGAGAGGGGGGGAGGGCTAGGTTGTAG
Transcript >Ani_SJS72_1|g6399.t1
ATGTCCCGCTCCAGCGAAGGCTACCTCTGGACTCCCAAGCAAGCCACCTCAGGTCTACCCACAGACGCAGTCCAC
CCCAGCACGCCCGCCCTCCGCACCCACTACGACGTGATAGTCATCGGGGCCGGATTCGCCGGACTAATTGCAGCC
CGCGACCTAAGCAGGAAGCACAATCTCAACGTCCTGCTCCTAGAAGCGCGGGACCGCATCGGCGGTCGAACATGG
ACAGCCAAGGTCCTCGGCGAGGAGATCGAAATGGGCGGGACCTGGGTTCACTGGAACCAGCCGCATCTGTATGCC
GAGCTGCATCGGTACGGACTGCACCGGAATCTGAAGACCTCTGCGGGGTCATTCACGCCTGTGGATCAGTGGTTC
AAGTCCAGTAGTGGTCCTGTGGAGAAGGTTTCTGTTGGAGATTACCAGGCTACGCTTGAGCGCGTTGCAGAGAAG
TTTTTCGCAATTGATGGGCTGGACAGTCGTGCGTTGATGCCGTATCCGCATGATTCGCTGAGGGGGCCGGCGCCG
TGGAAGAGGTATGATTATCTTAGTGTGGAGGAGCGGTTGGAGATGTCGGATTTGGATGGGTTGTCGAGGTGGGAG
AAAGTGCTGTTTGCGTCTAATGTTAGTACGTTTGGGAGTGCGCCGGTGAAGGATATTGGATTTGTGGAGGCGCTG
CGGTGGTTTGCGCTGGGAGGGCATAGTATGGCTGGGGTGTTTGAGTTGGCGGGGGTGTACAAATTGGGGAGTGGA
GGGATGACTTCTTTTGCGAGGGCTATTTTGGGGGAGTTCACTGGTCATGTTAGCTTTGGAACGGTTGTTGAGCAG
ATTGATCATGGTCGTGATATGGTGGAGGTTGTCACTAAGGATGGGAGGAGGGTTGGGGCTCGTGCGGTGGTGTCG
ACGGTTCCGCTAAACTGCCTCAACGACATCCAATTTCAACCCCCACTCACCCCCCTCCGACAAGCAGCCATCACA
AAAGGCCACATTAACAAAGGCGCAAAGATCCACTTCAAGCTTCGCGAAACACTACCGGGTTGGTTCTTTACTGCA
CATGACGGCAGTGACTCCAGCTTTGTCTTTGCGTTCTCAGATCACAATGGAACCCAGCTAACAGGCCCGTCTGGC
ACCTGGTGCATTGGATTTGGGTACAACGATCAACTTACTAATAAGAAGGATAGCAAATATATCTTGCAGAGATTC
AAGCATGATGTTAACCCGGATGTGGATATTGATGCCTATGCCACCCATGATTGGATGAATGATCCGTATGCGAAA
GGGGCTTGGGCGTGCTGGGGACCAAATACTGCGTCAGAATACTTGGAGGAACTTCAGAAACCGCATGGACGGGTT
GTGTTTGCGAGCGCGGATTGGGCGGACGGGTGGAGGGGGTTTGTGGATGGTGCGATTGAGAGGGGACAGGCTGCT
GTGGGGGAGGTTTTGGGGATGCTGGAGGGGAGAGAGGGGGGGAGGGCTAGGTTGTAG
Gene >Ani_SJS72_1|g6399.t1
ATGTCCCGCTCCAGCGAAGGCTACCTCTGGACTCCCAAGCAAGCCACCTCAGGTCTACCCACAGACGCAGTCCAC
CCCAGCACGCCCGCCCTCCGCACCCACTACGACGTGATAGTCATCGGGGCCGGATTCGCCGGACTAATTGCAGCC
CGCGACCTAAGCAGGAAGCACAATCTCAACGTCCTGCTCCTAGAAGCGCGGGACCGCATCGGCGGTCGAACATGG
ACAGCCAAGGTCCTCGGCGAGGAGATCGAAATGGGCGGGACCTGGGTTCACTGGAACCAGCCGCATCTGTATGCC
GAGCTGCATCGGTACGGACTGCACCGGAATCTGAAGACCTCTGCGGGGTCATTCACGCCTGTGGATCAGTGGTTC
AAGTCCAGTAGTGGTCCTGTGGAGAAGGTTTCTGTTGGAGATTACCAGGCTACGCTTGAGCGCGTTGCAGAGAAG
TTTTTCGCAATTGATGGGCTGGACAGTCGTGCGTTGATGCCGTATCCGCATGATTCGCTGAGGGGGCCGGCGCCG
TGGAAGAGGTATGATTATCTTAGTGTGGAGGAGCGGTTGGAGATGTCGGATTTGGATGGGTTGTCGAGGTGGGAG
AAAGTGCTGTTTGCGTCTAATGTTAGTACGTTTGGGAGTGCGCCGGTGAAGGATATTGGATTTGTGGAGGCGCTG
CGGTGGTTTGCGCTGGGAGGGCATAGTATGGCTGGGGTGTTTGAGTTGGCGGGGGTGTACAAATTGGGGAGTGGA
GGGATGACTTCTTTTGCGAGGGCTATTTTGGGGGAGTTCACTGGTCATGTTAGCTTTGGAACGGTTGTTGAGCAG
ATTGATCATGGTCGTGATATGGTGGAGGTTGTCACTAAGGATGGGAGGAGGGTTGGGGCTCGTGCGGTGGTGTCG
ACGGTTCCGCTGTATGTTTCTTTCCTATCTCACCTTCTGTTGCTTTAGATATATCCACCTGACTAACCTAACGAC
AGAAACTGCCTCAACGACATCCAATTTCAACCCCCACTCACCCCCCTCCGACAAGCAGCCATCACAAAAGGCCAC
ATTAACAAAGGCGCAAAGATCCACTTCAAGCTTCGCGAAACACTACCGGGTTGGTTCTTTACTGCACATGACGGC
AGTGACTCCAGCTTTGTCTTTGCGTTCTCAGATCACAATGGAACCCAGCTAACAGGCCCGTCTGGCACCTGGTGC
ATTGGATTTGGGTACAACGATCAACTTACTAATAAGAAGGATAGCAAATATATCTTGCAGAGATTCAAGCATGAT
GTTAACCCGGATGTGGATATTGATGCCTATGCCACCCATGATTGGATGAATGATCCGTATGCGAAAGGGGCTTGG
GCGTGCTGGGGACCAAATACTGCGTCAGAATACTTGGAGGAACTTCAGAAACCGCATGGACGGGTTGTGTTTGCG
AGCGCGGATTGGGCGGACGGGTGGAGGGGGTTTGTGGATGGTGCGATTGAGAGGGGACAGGCTGCTGTGGGGGAG
GTTTTGGGGATGCTGGAGGGGAGAGAGGGGGGGAGGGCTAGGTTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail