Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g6232.t1
Gene name
Locationscaffold_046:6009..7026
Strand-
Gene length (bp)1017
Transcript length (bp)963
Coding sequence length (bp)963
Protein length (aa) 321

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04479 RTA1 RTA1 like protein 1.0E-65 83 304

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 51 73 22
2 78 100 22
3 110 132 22
4 152 174 22
5 194 216 22
6 237 259 22
7 279 301 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g6232.t1
MTNCTTDWSNVTLATFNQTLLNDTSLCTKCTCPLVLDGEQLSWVRYYPNLAGNVLYAVLFGLFLVLQLFFGISRK
TRGYMIGMTLGLILEVLGYVGRILLRYSMFEFSWFLMYLVPLTIAPAFISAAIYLTLSRIITIYGAEHARFRPQV
YTYIFITFDIIALLLQAVGGAVASVADAYSSMQDQGVHVMVGGLAWQVVSLFIFSCLGLDFYLRVSRASRKGVPL
NPAFDSLRAQRSFEPWFIVSLSLAVLFIFVRSVFRCAELQGGFGGKLANEEITFMVLEGAMMVLACGLLTFFHPG
LILGAREWALAKWSRGGKGV*
Coding >Ani_SJS72_1|g6232.t1
ATGACGAACTGCACTACCGATTGGAGCAATGTCACGCTCGCTACTTTCAACCAGACTCTACTCAATGATACCTCA
TTGTGTACGAAATGCACCTGTCCTCTCGTCCTGGACGGCGAGCAGCTGTCATGGGTGCGATACTACCCGAATCTG
GCGGGCAACGTCCTCTACGCAGTCCTCTTCGGCCTCTTTCTCGTGCTGCAGCTCTTCTTCGGCATCTCGCGCAAG
ACCCGGGGATACATGATTGGCATGACACTTGGTTTGATTCTTGAAGTCTTGGGCTACGTCGGACGGATTCTCCTC
CGCTACTCGATGTTCGAATTCTCATGGTTCCTGATGTATCTCGTTCCTCTCACCATCGCCCCGGCCTTCATCTCC
GCAGCCATCTATCTGACCCTATCGCGGATCATCACGATCTATGGCGCCGAGCACGCTCGCTTCCGCCCCCAGGTC
TACACCTACATCTTCATCACCTTCGACATCATCGCCCTTCTTCTGCAAGCCGTGGGCGGCGCCGTCGCCTCCGTC
GCTGACGCCTACTCATCCATGCAGGACCAGGGTGTGCACGTCATGGTCGGCGGCCTTGCGTGGCAGGTGGTGTCG
CTGTTCATCTTCTCGTGCCTGGGTCTGGACTTCTATCTGCGCGTGAGCCGGGCTAGCCGCAAAGGAGTCCCTCTC
AACCCGGCGTTTGATTCGCTACGCGCACAGCGGTCCTTCGAGCCGTGGTTCATTGTGTCCCTGTCTCTGGCCGTC
TTGTTTATCTTTGTGCGGAGTGTGTTCCGGTGTGCTGAGCTACAGGGTGGATTTGGCGGCAAGTTGGCCAATGAG
GAGATTACGTTCATGGTGCTGGAGGGAGCGATGATGGTGCTGGCTTGTGGGTTGTTGACTTTCTTCCACCCCGGG
TTGATTTTGGGGGCTAGGGAATGGGCGCTGGCTAAGTGGAGTCGCGGTGGTAAGGGGGTCTAG
Transcript >Ani_SJS72_1|g6232.t1
ATGACGAACTGCACTACCGATTGGAGCAATGTCACGCTCGCTACTTTCAACCAGACTCTACTCAATGATACCTCA
TTGTGTACGAAATGCACCTGTCCTCTCGTCCTGGACGGCGAGCAGCTGTCATGGGTGCGATACTACCCGAATCTG
GCGGGCAACGTCCTCTACGCAGTCCTCTTCGGCCTCTTTCTCGTGCTGCAGCTCTTCTTCGGCATCTCGCGCAAG
ACCCGGGGATACATGATTGGCATGACACTTGGTTTGATTCTTGAAGTCTTGGGCTACGTCGGACGGATTCTCCTC
CGCTACTCGATGTTCGAATTCTCATGGTTCCTGATGTATCTCGTTCCTCTCACCATCGCCCCGGCCTTCATCTCC
GCAGCCATCTATCTGACCCTATCGCGGATCATCACGATCTATGGCGCCGAGCACGCTCGCTTCCGCCCCCAGGTC
TACACCTACATCTTCATCACCTTCGACATCATCGCCCTTCTTCTGCAAGCCGTGGGCGGCGCCGTCGCCTCCGTC
GCTGACGCCTACTCATCCATGCAGGACCAGGGTGTGCACGTCATGGTCGGCGGCCTTGCGTGGCAGGTGGTGTCG
CTGTTCATCTTCTCGTGCCTGGGTCTGGACTTCTATCTGCGCGTGAGCCGGGCTAGCCGCAAAGGAGTCCCTCTC
AACCCGGCGTTTGATTCGCTACGCGCACAGCGGTCCTTCGAGCCGTGGTTCATTGTGTCCCTGTCTCTGGCCGTC
TTGTTTATCTTTGTGCGGAGTGTGTTCCGGTGTGCTGAGCTACAGGGTGGATTTGGCGGCAAGTTGGCCAATGAG
GAGATTACGTTCATGGTGCTGGAGGGAGCGATGATGGTGCTGGCTTGTGGGTTGTTGACTTTCTTCCACCCCGGG
TTGATTTTGGGGGCTAGGGAATGGGCGCTGGCTAAGTGGAGTCGCGGTGGTAAGGGGGTCTAG
Gene >Ani_SJS72_1|g6232.t1
ATGACGAACTGCACTACCGATTGGAGCAATGTCACGCTCGCTACTTTCAACCAGACTCTACTCAATGATACCTCA
TTGTGTACGAAATGCACCTGTCCTCTCGTCCTGGACGGCGAGCAGCTGTCATGGGTGCGATACTACCCGAATCTG
GCGGGCAACGTCCTCTACGCAGTCCTCTTCGGCCTCTTTCTCGTGCTGCAGCTCTTCTTCGGCATCTCGCGCAAG
ACCCGGGGATACATGATTGGCATGACACTTGGTTTGATTCTTGAAGTCTTGGGCTACGTCGGACGGATTCTCCTC
CGCTACTCGATGTTCGAATTCTCATGGTTCCTGATGTGAGTTTCCCTCTAAAATAAAACCTAAGGTGTGAAAATT
AACAACCATGACAGGTATCTCGTTCCTCTCACCATCGCCCCGGCCTTCATCTCCGCAGCCATCTATCTGACCCTA
TCGCGGATCATCACGATCTATGGCGCCGAGCACGCTCGCTTCCGCCCCCAGGTCTACACCTACATCTTCATCACC
TTCGACATCATCGCCCTTCTTCTGCAAGCCGTGGGCGGCGCCGTCGCCTCCGTCGCTGACGCCTACTCATCCATG
CAGGACCAGGGTGTGCACGTCATGGTCGGCGGCCTTGCGTGGCAGGTGGTGTCGCTGTTCATCTTCTCGTGCCTG
GGTCTGGACTTCTATCTGCGCGTGAGCCGGGCTAGCCGCAAAGGAGTCCCTCTCAACCCGGCGTTTGATTCGCTA
CGCGCACAGCGGTCCTTCGAGCCGTGGTTCATTGTGTCCCTGTCTCTGGCCGTCTTGTTTATCTTTGTGCGGAGT
GTGTTCCGGTGTGCTGAGCTACAGGGTGGATTTGGCGGCAAGTTGGCCAATGAGGAGATTACGTTCATGGTGCTG
GAGGGAGCGATGATGGTGCTGGCTTGTGGGTTGTTGACTTTCTTCCACCCCGGGTTGATTTTGGGGGCTAGGGAA
TGGGCGCTGGCTAAGTGGAGTCGCGGTGGTAAGGGGGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail