Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g617.t1
Gene name
Locationscaffold_003:143018..145374
Strand-
Gene length (bp)2356
Transcript length (bp)1869
Coding sequence length (bp)1869
Protein length (aa) 623

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13641 Glyco_tranf_2_3 Glycosyltransferase like family 2 2.1E-17 113 343
PF13632 Glyco_trans_2_3 Glycosyl transferase family group 2 3.4E-15 210 425
PF00535 Glycos_transf_2 Glycosyl transferase family 2 6.8E-14 116 289

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 374 396 22
2 403 425 22
3 500 522 22
4 529 551 22
5 599 621 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g617.t1
MHFAPLRQMLSKLLYDIQELPPDHRVVAGQRHRRLLYYVAHLASWTSNLYLVLRLALCFSAVQQNWRAWLTLLVE
TVLAIIWRHDQLLTMLGGSASESQPRKRLRLHGTDDLPQVDILVPCCGEPVDVILDTVRAACTMDYPVSSFRVRV
LDDGASTELESAVAALRTEWPHLFYHTRGRQSGKVFAKAGNMNYALFTLQEKAPPEFCAIFDADSIPMPHFLRAT
LPHLLQTPEAVLLTTRQYFYNLPSGDPLSQSRLHFYTCENAELDRRGLAQDAGSGALFRRQAIIDAGGYPTYSFS
EDWQLSLVLKGLGHRTIQVQEPLQFGLVPTSLDGHIAQRNRWHIGHSQQLRVLMPPTNKTLPRSLQWSIAQNGVF
IMAGGLGCLISFAMVPLLLASGQLVPDISPLLAKAQFLLAVLHIALTWAYGLLQSAHTGFESFPFSRFENIWLAG
AHMHAVARFHLLASRPKGSFVTGSSANSWNRSATPTSFQKLYHNLWHNGIAYSIVVLLATIASIVYSIYTAITTT
DDRLLSRLLTTIAWPPMLHICYLSIVSYWAPVSYLLNPPRYPERKAGLALSETGVVLPSPEVQQAAMVLGKAPVG
FYRQCVVVVLVLGGLLLGGLTL*
Coding >Ani_SJS72_1|g617.t1
ATGCACTTCGCACCGCTCCGACAAATGCTGTCTAAACTGCTCTACGACATTCAGGAGCTCCCGCCTGACCATCGC
GTTGTCGCGGGACAGCGGCACCGACGCTTGCTCTATTACGTAGCCCATCTGGCATCATGGACCTCCAACCTTTAT
CTCGTCCTTCGCCTAGCTCTGTGTTTCTCTGCTGTGCAACAAAATTGGCGAGCCTGGCTAACTCTGTTGGTCGAG
ACCGTTCTCGCCATCATTTGGCGTCATGATCAGCTTCTCACCATGTTAGGTGGTTCGGCATCAGAGAGCCAACCA
CGCAAAAGACTGCGATTACACGGCACCGACGATCTACCGCAGGTGGACATTTTGGTGCCCTGCTGCGGAGAGCCT
GTCGACGTCATTTTGGACACCGTGCGTGCTGCCTGTACAATGGACTATCCAGTTTCCAGCTTCCGGGTCCGTGTA
TTGGACGATGGTGCTTCCACAGAGCTCGAGTCCGCCGTTGCAGCACTGCGCACTGAATGGCCTCACCTCTTCTAC
CACACGCGCGGAAGGCAATCCGGTAAGGTCTTCGCCAAGGCTGGTAACATGAATTACGCCCTGTTCACCCTGCAA
GAAAAGGCTCCACCTGAGTTTTGTGCCATCTTCGATGCAGACTCCATCCCCATGCCTCACTTTCTGAGGGCGACG
TTGCCCCATCTCCTTCAGACCCCGGAAGCCGTGCTCCTCACCACCCGGCAGTACTTTTACAACCTCCCATCAGGT
GACCCCCTTTCCCAGTCACGCCTCCACTTCTACACCTGTGAAAATGCAGAGCTCGATCGTCGAGGTCTTGCTCAG
GATGCAGGCTCCGGGGCCCTCTTCCGGAGACAAGCCATCATCGATGCAGGTGGATATCCGACGTACAGCTTCTCC
GAGGATTGGCAGCTGTCGCTTGTTCTGAAGGGGCTAGGCCACCGCACCATCCAAGTCCAGGAGCCGTTACAATTC
GGATTGGTTCCGACGTCCTTGGATGGACACATTGCACAGCGCAACCGGTGGCACATTGGCCACTCTCAACAGCTT
CGGGTGTTGATGCCGCCCACAAACAAGACACTTCCCCGCTCGCTGCAGTGGAGTATTGCACAGAATGGCGTCTTC
ATCATGGCTGGAGGCCTTGGCTGTTTGATTTCATTTGCAATGGTTCCATTGCTTCTGGCATCGGGTCAGCTGGTC
CCAGACATTTCGCCATTGCTGGCCAAAGCACAGTTTCTTCTGGCTGTTCTCCATATCGCCTTGACATGGGCGTAT
GGACTTTTGCAAAGCGCGCACACGGGATTCGAAAGCTTTCCGTTTTCTCGTTTTGAAAATATCTGGCTGGCAGGA
GCTCACATGCACGCCGTCGCTCGATTCCACCTGCTCGCCAGCCGACCCAAAGGCTCCTTCGTAACTGGCAGCAGC
GCCAACTCATGGAATCGCAGCGCGACCCCAACATCCTTCCAGAAGCTCTACCACAATCTGTGGCACAACGGGATC
GCATACAGCATTGTCGTTTTGCTTGCCACTATCGCATCCATCGTCTACTCGATCTACACGGCTATCACAACCACT
GATGATAGGCTGTTATCCCGCTTGCTCACCACGATTGCTTGGCCGCCGATGCTTCACATCTGCTACCTCTCCATC
GTCAGTTACTGGGCACCAGTCTCATATCTGCTGAACCCGCCGCGGTATCCGGAGCGGAAGGCTGGATTGGCTTTG
TCGGAGACGGGCGTGGTGCTTCCGAGTCCGGAGGTCCAGCAAGCAGCTATGGTGCTTGGGAAAGCACCGGTTGGG
TTCTATCGTCAGTGCGTGGTGGTCGTGTTGGTTCTGGGGGGGTTATTGTTGGGTGGATTGACGTTGTGA
Transcript >Ani_SJS72_1|g617.t1
ATGCACTTCGCACCGCTCCGACAAATGCTGTCTAAACTGCTCTACGACATTCAGGAGCTCCCGCCTGACCATCGC
GTTGTCGCGGGACAGCGGCACCGACGCTTGCTCTATTACGTAGCCCATCTGGCATCATGGACCTCCAACCTTTAT
CTCGTCCTTCGCCTAGCTCTGTGTTTCTCTGCTGTGCAACAAAATTGGCGAGCCTGGCTAACTCTGTTGGTCGAG
ACCGTTCTCGCCATCATTTGGCGTCATGATCAGCTTCTCACCATGTTAGGTGGTTCGGCATCAGAGAGCCAACCA
CGCAAAAGACTGCGATTACACGGCACCGACGATCTACCGCAGGTGGACATTTTGGTGCCCTGCTGCGGAGAGCCT
GTCGACGTCATTTTGGACACCGTGCGTGCTGCCTGTACAATGGACTATCCAGTTTCCAGCTTCCGGGTCCGTGTA
TTGGACGATGGTGCTTCCACAGAGCTCGAGTCCGCCGTTGCAGCACTGCGCACTGAATGGCCTCACCTCTTCTAC
CACACGCGCGGAAGGCAATCCGGTAAGGTCTTCGCCAAGGCTGGTAACATGAATTACGCCCTGTTCACCCTGCAA
GAAAAGGCTCCACCTGAGTTTTGTGCCATCTTCGATGCAGACTCCATCCCCATGCCTCACTTTCTGAGGGCGACG
TTGCCCCATCTCCTTCAGACCCCGGAAGCCGTGCTCCTCACCACCCGGCAGTACTTTTACAACCTCCCATCAGGT
GACCCCCTTTCCCAGTCACGCCTCCACTTCTACACCTGTGAAAATGCAGAGCTCGATCGTCGAGGTCTTGCTCAG
GATGCAGGCTCCGGGGCCCTCTTCCGGAGACAAGCCATCATCGATGCAGGTGGATATCCGACGTACAGCTTCTCC
GAGGATTGGCAGCTGTCGCTTGTTCTGAAGGGGCTAGGCCACCGCACCATCCAAGTCCAGGAGCCGTTACAATTC
GGATTGGTTCCGACGTCCTTGGATGGACACATTGCACAGCGCAACCGGTGGCACATTGGCCACTCTCAACAGCTT
CGGGTGTTGATGCCGCCCACAAACAAGACACTTCCCCGCTCGCTGCAGTGGAGTATTGCACAGAATGGCGTCTTC
ATCATGGCTGGAGGCCTTGGCTGTTTGATTTCATTTGCAATGGTTCCATTGCTTCTGGCATCGGGTCAGCTGGTC
CCAGACATTTCGCCATTGCTGGCCAAAGCACAGTTTCTTCTGGCTGTTCTCCATATCGCCTTGACATGGGCGTAT
GGACTTTTGCAAAGCGCGCACACGGGATTCGAAAGCTTTCCGTTTTCTCGTTTTGAAAATATCTGGCTGGCAGGA
GCTCACATGCACGCCGTCGCTCGATTCCACCTGCTCGCCAGCCGACCCAAAGGCTCCTTCGTAACTGGCAGCAGC
GCCAACTCATGGAATCGCAGCGCGACCCCAACATCCTTCCAGAAGCTCTACCACAATCTGTGGCACAACGGGATC
GCATACAGCATTGTCGTTTTGCTTGCCACTATCGCATCCATCGTCTACTCGATCTACACGGCTATCACAACCACT
GATGATAGGCTGTTATCCCGCTTGCTCACCACGATTGCTTGGCCGCCGATGCTTCACATCTGCTACCTCTCCATC
GTCAGTTACTGGGCACCAGTCTCATATCTGCTGAACCCGCCGCGGTATCCGGAGCGGAAGGCTGGATTGGCTTTG
TCGGAGACGGGCGTGGTGCTTCCGAGTCCGGAGGTCCAGCAAGCAGCTATGGTGCTTGGGAAAGCACCGGTTGGG
TTCTATCGTCAGTGCGTGGTGGTCGTGTTGGTTCTGGGGGGGTTATTGTTGGGTGGATTGACGTTGTGA
Gene >Ani_SJS72_1|g617.t1
ATGCACTGTGAGTTGGTTTGTATTTCACGGGCATTGTGTGCATAGTACCGGCCATTGCAGTGGTGTGGTGATCCA
TGCTCTGCTACTAAGCACCCCGGCCAGTTTCACTAGCAACAGAGCACCAGACTCGGTGGAACACTGTGTCTGACT
ACGCATCGTAGACTGCTTTGGATTTACAGGGTCTACATCTGACGGTGGTCTCAGTCGCACCGCTCCGACAAATGC
TGTCTAAACTGCTCTACGACATTCAGGAGCTCCCGCCTGACCATCGCGTTGTCGCGGGACAGCGGCACCGACGCT
TGCTCTATTACGTAGCCCATCTGGCATCATGGACCTCCAACCTTTATCTCGTCCTTCGCCTAGCTCTGTGTTTCT
CTGCTGTGCAACAAAATTGGCGAGCCTGGCTAACTCTGTTGGTCGAGACCGTTCTCGCCAGTATGTCTATACCAC
CGTGAACTGCCGTGTTTCGACACGCCGGCTCCCTTTTCGAGCAAACGAGGACGCGCAAGCTAATATGTTTTCAGT
CATTTGGCGTCATGATCAGCTTCTCACCATGTTAGGTGGTTCGGCATCAGAGAGCCAACCACGCAAAAGACTGCG
ATTACACGGCACCGACGATCTACCGCAGGTGGACATTTTGGTGCCCTGCTGCGGAGAGCCTGTCGACGTCATTTT
GGACACCGTGCGTGCTGCCTGTACAATGGACTATCCAGTTTCCAGCTTCCGGGTCCGTGTATTGGACGATGGTGC
TTCCACAGAGCTCGAGTCCGCCGTTGCAGCACTGCGCACTGAATGGCCTCACCTCTTCTACCACACGCGCGGAAG
GCAATCCGGTAAGGTCTTCGCCAAGGCTGGTAACATGAATTACGCCCTGTTCACCCTGCAAGAAAAGGCTCCACC
TGAGTTTTGTGCCATCTTCGATGCAGACTCCATCCCCATGCCTCACTTTCTGAGGGCGACGTTGCCCCATCTCCT
TCAGACCCCGGAAGCCGTGCTCCTCACCACCCGGCAGTACTTTTACAACCTCCCATCAGGTGACCCCCTTTCCCA
GTCACGCCTCCACTTCTACACCTGTGAAAATGCAGAGCTCGATCGTCGAGGTCTTGCTCAGGATGCAGGCTCCGG
GGCCCTCTTCCGGAGACAAGCCATCATCGATGCAGGTGGATATCCGACGTACAGCTTCTCCGAGGATTGGCAGCT
GTCGCTTGTTCTGAAGGGGCTAGGCCACCGCACCATCCAAGTCCAGGAGCCGTTACAATTCGGATTGGTTCCGAC
GTCCTTGGATGGACACATTGCACAGCGCAACCGGTGGCACATTGGCCACTCTCAACAGCTTCGGGTGTTGATGCC
GCCCACAAACAAGACACTTCCCCGCTCGCTGCAGTGGAGTATTGCACAGAATGGCGTCTTCATCATGGCTGGAGG
CCTTGGCTGTTTGATTTCATTTGCAATGGTTCCATTGCTTCTGGCATCGGGTCAGCTGGTCCCAGACATTTCGCC
ATTGCTGGCCAAAGCACAGTTTCTTCTGGCTGTTCTCCATATCGCCTTGACATGGGCGTATGGACTTTTGCAAAG
CGCGCACACGGGATTCGAAAGCTTTCCGTTTTCTCGTTTTGAAAATATCTGGCTGGCAGGAGGTAAGATACATAC
CTTTGTTTTTTATTGTTCTGTTGTACAGTTGCGTATTGTCATTACCCGTTCTATTATGGTCTTGAATGGTTCCTG
GACTTCACCTTCTACCACTTTGTTCCTGATATTCTCTCACCCTGCGTCCCTCCGCGATAGGAGTTCTCTCTCTCT
CATTCTACCACTCTTCAAGATGAAACTAACAATAACAGCTCACATGCACGCCGTCGCTCGATTCCACCTGCTCGC
CAGCCGACCCAAAGGCTCCTTCGTAACTGGCAGCAGCGCCAACTCATGGAATCGCAGCGCGACCCCAACATCCTT
CCAGAAGCTCTACCACAATCTGTGGCACAACGGGATCGCATACAGCATTGTCGTTTTGCTTGCCACTATCGCATC
CATCGTCTACTCGATCTACACGGCTATCACAACCACTGATGATAGGCTGTTATCCCGCTTGCTCACCACGATTGC
TTGGCCGCCGATGCTTCACATCTGCTACCTCTCCATCGTCAGTTACTGGGCACCAGTCTCATATCTGCTGAACCC
GCCGCGGTATCCGGAGCGGAAGGCTGGATTGGCTTTGTCGGAGACGGGCGTGGTGCTTCCGAGTCCGGAGGTCCA
GCAAGCAGCTATGGTGCTTGGGAAAGCACCGGTTGGGTTCTATCGTCAGTGCGTGGTGGTCGTGTTGGTTCTGGG
GGGGTTATTGTTGGGTGGATTGACGTTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail