Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g6162.t1
Gene name
Locationscaffold_045:45838..50195
Strand+
Gene length (bp)4357
Transcript length (bp)4302
Coding sequence length (bp)4302
Protein length (aa) 1434

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00689 Cation_ATPase_C Cation transporting ATPase, C-terminus 1.1E-47 1032 1207
PF00122 E1-E2_ATPase E1-E2 ATPase 3.6E-36 384 589
PF13246 Cation_ATPase Cation transport ATPase (P-type) 4.9E-21 679 768
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 1.3E-19 607 959
PF00690 Cation_ATPase_N Cation transporter/ATPase, N-terminus 9.9E-08 284 325

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 314 336 22
2 341 363 22
3 516 538 22
4 553 582 29
5 1005 1027 22
6 1083 1102 19
7 1153 1175 22
8 1185 1207 22
9 1322 1344 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID3
Orthogroup215
Change Orthofinder run
Species Protein ID
Aspergillus niger CBS 112.32 Ani_SJS6_1|g2152.t1
Aspergillus niger CBS 113.50 Ani_SJS3_1|g7487.t1
Aspergillus niger CBS 115988 Ani_SJS16_1|g447.t1
Aspergillus niger CBS 115989 Ani_SJS83_1|g670.t1
Aspergillus niger CBS 118.52 Ani_SJS14_1|g7287.t1
Aspergillus niger CBS 124.48 Ani_SJS7_1|g2704.t1
Aspergillus niger CBS 131.52 Ani_SJS8_1|g2164.t1
Aspergillus niger CBS 133816 Ani_SJS71_1|g1236.t1
Aspergillus niger CBS 147320 Ani_SJS28_1|g3705.t1
Aspergillus niger CBS 147321 Ani_SJS30_1|g4834.t1
Aspergillus niger CBS 147322 Ani_SJS35_1|g5841.t1
Aspergillus niger CBS 147323 Ani_SJS38_1|g5345.t1
Aspergillus niger CBS 147324 Ani_SJS39_1|g9548.t1
Aspergillus niger CBS 147343 Ani_SJS115_1|g6122.t1
Aspergillus niger CBS 147344 Ani_SJS70_1|g8854.t1
Aspergillus niger CBS 147345 Ani_SJS72_1|g6162.t1 (this protein)
Aspergillus niger CBS 147346 Ani_SJS75_1|g3140.t1
Aspergillus niger CBS 147347 Ani_SJS76_1|g2944.t1
Aspergillus niger CBS 147352 Ani_SJS95_1|g7159.t1
Aspergillus niger CBS 147353 Ani_SJS100_1|g1710.t1
Aspergillus niger CBS 147371 Ani_SJS27_1|g6517.t1
Aspergillus niger CBS 147482 Ani_SJS55_1|g9336.t1
Aspergillus niger CBS 630.78 Ani_SJS18_1|g8928.t1
Aspergillus niger CBS 630.78 Ani_SJS18_1|g5524.t1
Aspergillus niger CBS 769.97 Ani_SJS82_1|g1370.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g6162.t1
MSDSRSDGHDARQSGTTPLRRERAPTITIDTSAVTSPTDHQEPPQQILPTPSHPSLQVSTENVDAHDMSALLSSG
GVSPSSVRSFASSENRDYESRPTSPHNISSPASKMTENMSNSNYLAVPGTRSRGNSLESEDSNNSSTSSYGGDTY
VPTASHGSRTDLTQNTIISDEDALKPDPGREAEFEVEDNKFAFAPGHLNKLLNPKSLGAFHALGGLRGIEKGLRT
DTRSGLSLDEGDLDGTVSFEDATNTQTSESLPKTASSTPPSPPRTDTGSSKHVENAFGDRSRVYGRNKLPERKAK
SFLELAWIAYNDKVLILLTIAAIISLALGIYQSVTATGKEARVQWVEGVAIIVAILIVVVVGAANDWQKERQFVK
LNKKKDDRLVKVVRSGKTAEISIHDILVGDVMHLEPGDLIPVDGIFITGHNVKCDESSATGESDVLRKTPAHDVY
RAIEQHENISKQDPFIVSGAKVSEGVGTFLVTAVGVNSTYGKTMMSLQDEGQTTPLQSKLNVLAEYIAKLGLASG
LLLFVVLFIKFLAQLKDMGGASEKGQAFLQIFIVAVTVIVVAVPEGLPLAVTLALAFATTRMLKDNNLVRLLRAC
ETMGNATTICSDKTGTLTENKMTAVAATLGKNLRFGDKSTETSSRPDGDRGRDPATTLSPSEFASSLSAPAKDLL
IKSIVLNSTAFEGEQDGVMTFIGSKTETALLGFARTYLGLGSLSEARDNANLAQMVPFDSGRKCMAVVVKMENGK
YRMLVKGASEILVARSTRIVHNATQDLAEGPMSDQDRSNLDNLINRYASRSLRTIGLVYRDFDQWPPRGAPTQEE
DRSLAVFDAVFKDMILLGVFGIQDPLRPGVTESVHQCQRAGVFVRMVTGDNIMTAKAIAQECGIFTPGGIAIEGP
KFRQLSSRQMTQIIPRLQVLARSSPDDKKILVNQLKKLGETVAVTGDGTNDAQALKTADVGFSMGISGTEVAKEA
SDIILMDDNFTSIIKAMAWGRTVNDAVKKFLQFQLTVNVTAVVLTFVSAVASGDEESVLTAVQLLWVNLIMDTFA
ALALATDPPSPHVLDRRPDPKSAPLINLTMWKMIIGQSIYQLVVTLVLNFAGKSIFHYKTADDLDRLETMVFNTF
VWMQIFNQWNCRRLDNNFNIFEGMWRNFWFMGIQLIIIGGQILIIFVGGQAFSVKRLDGAQWGVSLVLGVISLPV
GVIIRLIPDEFISRLIPRFWQRKKGPELLVSDEDRRFEWNPALEEIRDQLKFLKTVRGGRLRHLKHKLQHPEELL
PRSRSGSRSRENSIPGTPVGEHSDSTPTQPPTPDSRSRRRTRSRSNSAFGPAAAMAGVVAGSIAGWSPIERAPGD
GEAFKVQTDSPHGGLDKQKGIEIHPDTAADDRILGDYQTTSKTPPSQNPGLLPFFEYAPPERAPSHRSQRSTSRL
SRSSQSQA*
Coding >Ani_SJS72_1|g6162.t1
ATGTCGGATTCCAGATCGGATGGTCATGATGCTAGGCAGTCAGGGACGACTCCCCTGCGACGGGAGCGGGCCCCA
ACCATCACCATCGATACGTCGGCTGTAACGTCCCCAACCGACCACCAAGAACCTCCACAGCAGATACTTCCTACC
CCGTCCCATCCCTCTTTGCAAGTGTCTACCGAAAATGTTGATGCGCATGATATGAGCGCGCTCCTGAGCAGTGGG
GGTGTCTCGCCGTCGTCAGTCCGCTCATTTGCGTCGTCTGAGAACCGGGACTACGAGAGTCGTCCTACATCTCCG
CACAATATCTCGTCTCCCGCCTCGAAAATGACTGAGAACATGTCGAATTCGAATTACCTGGCTGTCCCCGGCACT
AGGTCTCGCGGCAACTCGTTGGAATCTGAGGACTCGAATAATTCGTCGACCAGCTCGTACGGAGGAGATACATAT
GTTCCCACAGCATCCCACGGCTCGCGCACCGATTTGACGCAGAACACGATAATCTCCGATGAGGATGCCCTTAAG
CCGGATCCGGGGCGAGAGGCCGAGTTTGAGGTGGAAGACAACAAATTTGCATTCGCGCCTGGCCATTTGAACAAG
CTGTTGAACCCTAAGAGCTTGGGGGCATTCCATGCTTTGGGTGGGTTGCGTGGAATCGAAAAAGGACTTCGAACC
GACACGCGCAGTGGCTTGAGTTTGGATGAGGGAGACCTGGATGGTACTGTAAGCTTCGAGGATGCAACCAACACG
CAAACGTCCGAATCGCTGCCAAAGACCGCTTCCTCAACGCCACCGAGCCCTCCCAGAACCGACACGGGCTCGTCG
AAACATGTCGAAAATGCCTTTGGGGATCGAAGCCGCGTCTATGGGAGGAACAAGCTTCCTGAAAGGAAGGCTAAG
AGTTTCCTGGAGCTGGCTTGGATTGCCTACAACGACAAGGTTCTGATTCTGCTTACGATAGCTGCGATCATATCT
CTCGCCCTTGGAATCTATCAGTCTGTGACGGCAACCGGAAAGGAAGCACGCGTGCAATGGGTAGAAGGCGTGGCT
ATCATTGTCGCCATTCTAATCGTGGTCGTTGTGGGTGCTGCTAATGACTGGCAAAAGGAACGCCAATTCGTCAAG
TTGAATAAGAAGAAAGATGATCGACTTGTGAAAGTAGTCCGTTCCGGGAAAACTGCAGAGATCTCTATTCACGAC
ATTCTCGTGGGTGACGTTATGCATCTTGAACCCGGTGATCTCATTCCAGTTGACGGTATCTTTATTACTGGCCAC
AATGTCAAATGCGACGAATCCTCTGCGACCGGCGAGTCGGACGTCTTACGCAAGACCCCTGCTCACGATGTCTAT
CGGGCAATCGAGCAACACGAAAACATCTCGAAGCAGGACCCATTCATTGTGTCCGGTGCCAAAGTTTCTGAAGGT
GTAGGGACGTTCTTGGTCACAGCAGTCGGTGTTAATTCAACATACGGGAAGACCATGATGTCTCTTCAAGATGAA
GGGCAGACGACCCCGCTGCAATCGAAGCTGAACGTACTCGCAGAGTACATTGCGAAGCTCGGTCTTGCTTCTGGA
TTACTCCTGTTCGTCGTGCTTTTCATCAAGTTCCTTGCTCAGTTGAAAGATATGGGCGGCGCATCCGAGAAAGGA
CAAGCTTTCCTACAGATCTTCATTGTTGCTGTGACCGTCATTGTTGTCGCTGTCCCAGAAGGTCTTCCTCTGGCT
GTCACCCTGGCGCTCGCCTTTGCAACGACCCGGATGCTCAAGGACAATAACCTCGTACGGCTGCTAAGAGCCTGT
GAAACTATGGGAAATGCCACGACTATCTGCTCCGACAAAACAGGTACCCTGACGGAGAACAAAATGACTGCCGTC
GCAGCTACTCTGGGAAAGAATCTAAGATTTGGAGACAAATCCACGGAAACCTCCAGTCGTCCAGATGGCGACCGG
GGTCGTGATCCTGCGACTACTCTTTCTCCCTCCGAGTTCGCATCCAGCCTTTCCGCTCCGGCCAAAGACCTTTTG
ATCAAGTCGATTGTATTGAACTCCACGGCATTCGAAGGGGAGCAAGACGGTGTAATGACTTTTATCGGATCGAAG
ACGGAGACTGCTCTCCTGGGATTCGCGCGTACATATCTCGGCCTAGGGTCGCTTAGCGAGGCGCGGGACAATGCA
AATCTTGCCCAGATGGTGCCATTCGACTCAGGACGCAAGTGTATGGCAGTGGTCGTCAAGATGGAAAATGGTAAA
TACAGAATGCTGGTCAAAGGTGCATCCGAGATCCTGGTGGCGAGATCCACTCGAATTGTTCACAACGCTACGCAG
GACTTGGCAGAAGGGCCTATGTCGGATCAGGACCGGTCTAACCTGGACAATTTGATCAACCGTTATGCATCTCGT
TCGTTGCGAACTATTGGTCTGGTGTACCGGGACTTCGATCAATGGCCACCCCGCGGAGCACCCACGCAGGAGGAG
GACCGTTCGCTCGCTGTTTTCGATGCAGTTTTCAAGGATATGATCTTGCTAGGCGTCTTCGGTATCCAAGATCCC
TTGCGACCGGGTGTGACCGAGTCTGTCCACCAGTGTCAGCGCGCAGGTGTCTTTGTGCGTATGGTGACTGGCGAT
AACATCATGACTGCTAAAGCTATCGCCCAAGAATGTGGCATCTTCACCCCTGGAGGTATTGCCATTGAGGGCCCC
AAGTTCCGTCAGCTGAGCAGCCGCCAAATGACGCAGATCATCCCGCGGCTACAGGTTTTGGCCAGGTCAAGCCCC
GACGACAAGAAGATCCTGGTTAATCAACTCAAAAAGCTGGGTGAAACGGTGGCTGTGACAGGCGACGGTACAAAT
GATGCACAAGCTCTCAAGACGGCCGATGTTGGCTTTTCCATGGGAATCTCTGGCACTGAAGTTGCTAAAGAAGCA
TCCGATATCATCCTCATGGACGACAACTTCACCTCGATTATTAAGGCTATGGCTTGGGGTAGGACAGTCAACGAT
GCTGTCAAGAAATTCCTTCAGTTCCAACTTACTGTCAACGTTACTGCCGTGGTCCTCACTTTCGTTTCCGCAGTA
GCAAGTGGAGATGAGGAATCTGTCCTGACAGCAGTTCAGCTTCTTTGGGTCAACCTTATCATGGACACCTTTGCG
GCCCTTGCCTTGGCTACGGATCCTCCCTCGCCTCATGTTCTCGACCGTCGACCTGACCCTAAATCGGCGCCCCTG
ATCAATCTGACTATGTGGAAGATGATTATCGGACAAAGCATCTACCAGTTAGTCGTCACGCTGGTTCTGAACTTC
GCAGGGAAATCGATCTTTCACTACAAAACGGCAGACGACCTCGATCGGCTTGAGACCATGGTGTTCAATACGTTT
GTGTGGATGCAGATCTTCAACCAGTGGAATTGTCGCAGACTCGATAACAACTTCAATATCTTTGAGGGCATGTGG
CGAAACTTCTGGTTCATGGGGATTCAGTTGATCATCATTGGAGGTCAAATTCTCATCATCTTCGTTGGTGGACAG
GCTTTCTCTGTCAAGCGACTCGATGGAGCTCAGTGGGGTGTTTCACTGGTTCTGGGCGTGATCTCTCTGCCGGTA
GGCGTGATCATTCGTTTGATACCTGATGAGTTTATTAGCAGACTCATTCCTCGGTTCTGGCAGCGCAAGAAGGGC
CCCGAACTTCTGGTGTCCGACGAGGACCGGCGGTTTGAGTGGAACCCTGCGCTCGAGGAGATCCGTGATCAGTTG
AAGTTCCTCAAGACGGTCCGCGGAGGTCGGCTGAGGCACCTCAAGCACAAGTTGCAACATCCAGAAGAACTCCTC
CCAAGATCACGAAGCGGGTCACGGTCCAGAGAAAACTCGATTCCCGGTACTCCTGTTGGCGAACACAGCGACAGT
ACCCCGACGCAGCCACCGACTCCTGATTCGCGGTCTAGACGTCGCACTCGGTCCCGCTCGAATTCAGCATTCGGG
CCTGCTGCTGCTATGGCCGGTGTGGTTGCGGGTAGTATTGCAGGCTGGTCTCCAATCGAGCGGGCACCAGGCGAC
GGAGAAGCTTTCAAGGTTCAGACGGACAGCCCTCATGGGGGTCTGGATAAGCAGAAGGGCATTGAAATCCACCCC
GATACTGCCGCTGATGACCGTATTCTGGGCGATTACCAGACCACTTCAAAGACTCCTCCCAGCCAAAACCCAGGG
CTCCTCCCGTTCTTTGAATACGCACCGCCTGAGCGTGCTCCCTCCCATCGGAGCCAGAGATCCACTTCTCGCTTG
TCGCGATCCAGCCAAAGCCAGGCGTGA
Transcript >Ani_SJS72_1|g6162.t1
ATGTCGGATTCCAGATCGGATGGTCATGATGCTAGGCAGTCAGGGACGACTCCCCTGCGACGGGAGCGGGCCCCA
ACCATCACCATCGATACGTCGGCTGTAACGTCCCCAACCGACCACCAAGAACCTCCACAGCAGATACTTCCTACC
CCGTCCCATCCCTCTTTGCAAGTGTCTACCGAAAATGTTGATGCGCATGATATGAGCGCGCTCCTGAGCAGTGGG
GGTGTCTCGCCGTCGTCAGTCCGCTCATTTGCGTCGTCTGAGAACCGGGACTACGAGAGTCGTCCTACATCTCCG
CACAATATCTCGTCTCCCGCCTCGAAAATGACTGAGAACATGTCGAATTCGAATTACCTGGCTGTCCCCGGCACT
AGGTCTCGCGGCAACTCGTTGGAATCTGAGGACTCGAATAATTCGTCGACCAGCTCGTACGGAGGAGATACATAT
GTTCCCACAGCATCCCACGGCTCGCGCACCGATTTGACGCAGAACACGATAATCTCCGATGAGGATGCCCTTAAG
CCGGATCCGGGGCGAGAGGCCGAGTTTGAGGTGGAAGACAACAAATTTGCATTCGCGCCTGGCCATTTGAACAAG
CTGTTGAACCCTAAGAGCTTGGGGGCATTCCATGCTTTGGGTGGGTTGCGTGGAATCGAAAAAGGACTTCGAACC
GACACGCGCAGTGGCTTGAGTTTGGATGAGGGAGACCTGGATGGTACTGTAAGCTTCGAGGATGCAACCAACACG
CAAACGTCCGAATCGCTGCCAAAGACCGCTTCCTCAACGCCACCGAGCCCTCCCAGAACCGACACGGGCTCGTCG
AAACATGTCGAAAATGCCTTTGGGGATCGAAGCCGCGTCTATGGGAGGAACAAGCTTCCTGAAAGGAAGGCTAAG
AGTTTCCTGGAGCTGGCTTGGATTGCCTACAACGACAAGGTTCTGATTCTGCTTACGATAGCTGCGATCATATCT
CTCGCCCTTGGAATCTATCAGTCTGTGACGGCAACCGGAAAGGAAGCACGCGTGCAATGGGTAGAAGGCGTGGCT
ATCATTGTCGCCATTCTAATCGTGGTCGTTGTGGGTGCTGCTAATGACTGGCAAAAGGAACGCCAATTCGTCAAG
TTGAATAAGAAGAAAGATGATCGACTTGTGAAAGTAGTCCGTTCCGGGAAAACTGCAGAGATCTCTATTCACGAC
ATTCTCGTGGGTGACGTTATGCATCTTGAACCCGGTGATCTCATTCCAGTTGACGGTATCTTTATTACTGGCCAC
AATGTCAAATGCGACGAATCCTCTGCGACCGGCGAGTCGGACGTCTTACGCAAGACCCCTGCTCACGATGTCTAT
CGGGCAATCGAGCAACACGAAAACATCTCGAAGCAGGACCCATTCATTGTGTCCGGTGCCAAAGTTTCTGAAGGT
GTAGGGACGTTCTTGGTCACAGCAGTCGGTGTTAATTCAACATACGGGAAGACCATGATGTCTCTTCAAGATGAA
GGGCAGACGACCCCGCTGCAATCGAAGCTGAACGTACTCGCAGAGTACATTGCGAAGCTCGGTCTTGCTTCTGGA
TTACTCCTGTTCGTCGTGCTTTTCATCAAGTTCCTTGCTCAGTTGAAAGATATGGGCGGCGCATCCGAGAAAGGA
CAAGCTTTCCTACAGATCTTCATTGTTGCTGTGACCGTCATTGTTGTCGCTGTCCCAGAAGGTCTTCCTCTGGCT
GTCACCCTGGCGCTCGCCTTTGCAACGACCCGGATGCTCAAGGACAATAACCTCGTACGGCTGCTAAGAGCCTGT
GAAACTATGGGAAATGCCACGACTATCTGCTCCGACAAAACAGGTACCCTGACGGAGAACAAAATGACTGCCGTC
GCAGCTACTCTGGGAAAGAATCTAAGATTTGGAGACAAATCCACGGAAACCTCCAGTCGTCCAGATGGCGACCGG
GGTCGTGATCCTGCGACTACTCTTTCTCCCTCCGAGTTCGCATCCAGCCTTTCCGCTCCGGCCAAAGACCTTTTG
ATCAAGTCGATTGTATTGAACTCCACGGCATTCGAAGGGGAGCAAGACGGTGTAATGACTTTTATCGGATCGAAG
ACGGAGACTGCTCTCCTGGGATTCGCGCGTACATATCTCGGCCTAGGGTCGCTTAGCGAGGCGCGGGACAATGCA
AATCTTGCCCAGATGGTGCCATTCGACTCAGGACGCAAGTGTATGGCAGTGGTCGTCAAGATGGAAAATGGTAAA
TACAGAATGCTGGTCAAAGGTGCATCCGAGATCCTGGTGGCGAGATCCACTCGAATTGTTCACAACGCTACGCAG
GACTTGGCAGAAGGGCCTATGTCGGATCAGGACCGGTCTAACCTGGACAATTTGATCAACCGTTATGCATCTCGT
TCGTTGCGAACTATTGGTCTGGTGTACCGGGACTTCGATCAATGGCCACCCCGCGGAGCACCCACGCAGGAGGAG
GACCGTTCGCTCGCTGTTTTCGATGCAGTTTTCAAGGATATGATCTTGCTAGGCGTCTTCGGTATCCAAGATCCC
TTGCGACCGGGTGTGACCGAGTCTGTCCACCAGTGTCAGCGCGCAGGTGTCTTTGTGCGTATGGTGACTGGCGAT
AACATCATGACTGCTAAAGCTATCGCCCAAGAATGTGGCATCTTCACCCCTGGAGGTATTGCCATTGAGGGCCCC
AAGTTCCGTCAGCTGAGCAGCCGCCAAATGACGCAGATCATCCCGCGGCTACAGGTTTTGGCCAGGTCAAGCCCC
GACGACAAGAAGATCCTGGTTAATCAACTCAAAAAGCTGGGTGAAACGGTGGCTGTGACAGGCGACGGTACAAAT
GATGCACAAGCTCTCAAGACGGCCGATGTTGGCTTTTCCATGGGAATCTCTGGCACTGAAGTTGCTAAAGAAGCA
TCCGATATCATCCTCATGGACGACAACTTCACCTCGATTATTAAGGCTATGGCTTGGGGTAGGACAGTCAACGAT
GCTGTCAAGAAATTCCTTCAGTTCCAACTTACTGTCAACGTTACTGCCGTGGTCCTCACTTTCGTTTCCGCAGTA
GCAAGTGGAGATGAGGAATCTGTCCTGACAGCAGTTCAGCTTCTTTGGGTCAACCTTATCATGGACACCTTTGCG
GCCCTTGCCTTGGCTACGGATCCTCCCTCGCCTCATGTTCTCGACCGTCGACCTGACCCTAAATCGGCGCCCCTG
ATCAATCTGACTATGTGGAAGATGATTATCGGACAAAGCATCTACCAGTTAGTCGTCACGCTGGTTCTGAACTTC
GCAGGGAAATCGATCTTTCACTACAAAACGGCAGACGACCTCGATCGGCTTGAGACCATGGTGTTCAATACGTTT
GTGTGGATGCAGATCTTCAACCAGTGGAATTGTCGCAGACTCGATAACAACTTCAATATCTTTGAGGGCATGTGG
CGAAACTTCTGGTTCATGGGGATTCAGTTGATCATCATTGGAGGTCAAATTCTCATCATCTTCGTTGGTGGACAG
GCTTTCTCTGTCAAGCGACTCGATGGAGCTCAGTGGGGTGTTTCACTGGTTCTGGGCGTGATCTCTCTGCCGGTA
GGCGTGATCATTCGTTTGATACCTGATGAGTTTATTAGCAGACTCATTCCTCGGTTCTGGCAGCGCAAGAAGGGC
CCCGAACTTCTGGTGTCCGACGAGGACCGGCGGTTTGAGTGGAACCCTGCGCTCGAGGAGATCCGTGATCAGTTG
AAGTTCCTCAAGACGGTCCGCGGAGGTCGGCTGAGGCACCTCAAGCACAAGTTGCAACATCCAGAAGAACTCCTC
CCAAGATCACGAAGCGGGTCACGGTCCAGAGAAAACTCGATTCCCGGTACTCCTGTTGGCGAACACAGCGACAGT
ACCCCGACGCAGCCACCGACTCCTGATTCGCGGTCTAGACGTCGCACTCGGTCCCGCTCGAATTCAGCATTCGGG
CCTGCTGCTGCTATGGCCGGTGTGGTTGCGGGTAGTATTGCAGGCTGGTCTCCAATCGAGCGGGCACCAGGCGAC
GGAGAAGCTTTCAAGGTTCAGACGGACAGCCCTCATGGGGGTCTGGATAAGCAGAAGGGCATTGAAATCCACCCC
GATACTGCCGCTGATGACCGTATTCTGGGCGATTACCAGACCACTTCAAAGACTCCTCCCAGCCAAAACCCAGGG
CTCCTCCCGTTCTTTGAATACGCACCGCCTGAGCGTGCTCCCTCCCATCGGAGCCAGAGATCCACTTCTCGCTTG
TCGCGATCCAGCCAAAGCCAGGCGTGA
Gene >Ani_SJS72_1|g6162.t1
ATGTCGGATTCCAGATCGGATGGTCATGATGCTAGGCAGTCAGGGACGACTCCCCTGCGACGGGAGCGGGCCCCA
ACCATCACCATCGATACGTCGGCTGTAACGTCCCCAACCGACCACCAAGAACCTCCACAGCAGATACTTCCTACC
CCGTCCCATCCCTCTTTGCAAGTGTCTACCGAAAATGTTGATGCGCATGATATGAGCGCGCTCCTGAGCAGTGGG
GGTGTCTCGCCGTCGTCAGTCCGCTCATTTGCGTCGTCTGAGAACCGGGACTACGAGAGTCGTCCTACATCTCCG
CACAATATCTCGTCTCCCGCCTCGAAAATGACTGAGAACATGTCGAATTCGAATTACCTGGCTGTCCCCGGCACT
AGGTCTCGCGGCAACTCGTTGGAATCTGAGGACTCGAATAATTCGTCGACCAGCTCGTACGGAGGAGATACATAT
GTTCCCACAGCATCCCACGGCTCGCGCACCGATTTGACGCAGAACACGATAATCTCCGATGAGGATGCCCTTAAG
CCGGATCCGGGGCGAGAGGCCGAGTTTGAGGTGGAAGACAACAAATTTGCATTCGCGCCTGGCCATTTGAACAAG
CTGTTGAACCCTAAGAGCTTGGGGGCATTCCATGCTTTGGGTGGGTTGCGTGGAATCGAAAAAGGACTTCGAACC
GACACGCGCAGTGGCTTGAGTTTGGATGAGGGAGACCTGGATGGTACTGTAAGCTTCGAGGATGCAACCAACACG
CAAACGTCCGAATCGCTGCCAAAGACCGCTTCCTCAACGCCACCGAGCCCTCCCAGAACCGACACGGGCTCGTCG
AAACATGTCGAAAATGCCTTTGGGGATCGAAGCCGCGTCTATGGGAGGAACAAGCTTCCTGAAAGGAAGGCTAAG
AGTTTCCTGGAGCTGGCTTGGATTGCCTACAACGACAAGGTTCTGATTCTGCTTACGATAGCTGCGATCATATCT
CTCGCCCTTGGAATCTATCAGTCTGTGACGGCAACCGGAAAGGAAGCACGCGTGCAATGGGTAGAAGGCGTGGCT
ATCATTGTCGCCATTCTAATCGTGGTCGTTGTGGGTGCTGCTAATGACTGGCAAAAGGAACGCCAATTCGTCAAG
TTGAATAAGAAGAAAGATGATCGACTTGTGAAAGTAGTCCGTTCCGGGAAAACTGCAGAGATCTCTATTCACGAC
ATTCTCGTGGGTGACGTTATGCATCTTGAACCCGGTGATCTCATTCCAGTTGACGGTATCTTTATTACTGGCCAC
AATGTCAAATGCGACGAATCCTCTGCGACCGGCGAGTCGGACGTCTTACGCAAGACCCCTGCTCACGATGTCTAT
CGGGCAATCGAGCAACACGAAAACATCTCGAAGCAGGACCCATTCATTGTGTCCGGTGCCAAAGTTTCTGAAGGT
GTAGGGACGTTCTTGGTCACAGCAGTCGGTGTTAATTCAACATACGGGAAGACCATGATGTCTCTTCAAGATGAA
GGGCAGACGACCCCGCTGCAATCGAAGCTGAACGTACTCGCAGAGTACATTGCGAAGCTCGGTCTTGCTTCTGGA
TTACTCCTGTTCGTCGTGCTTTTCATCAAGTTCCTTGCTCAGTTGAAAGATATGGGCGGCGCATCCGAGAAAGGA
CAAGCTTTCCTACAGATCTTCATTGTTGCTGTGACCGTCATTGTTGTCGCTGTCCCAGAAGGTCTTCCTCTGGCT
GTCACCCTGGCGCTCGCCTTTGCAACGACCCGGATGCTCAAGGACAATAACCTCGTACGGCTGCTAAGAGCCTGT
GAAACTATGGGAAATGCCACGACTATCTGCTCCGACAAAACAGGTACCCTGACGGAGAACAAAATGACTGCCGTC
GCAGCTACTCTGGGAAAGAATCTAAGATTTGGAGACAAATCCACGGAAACCTCCAGTCGTCCAGATGGCGACCGG
GGTCGTGATCCTGCGACTACTCTTTCTCCCTCCGAGTTCGCATCCAGCCTTTCCGCTCCGGCCAAAGACCTTTTG
ATCAAGTCGATTGTATTGAACTCCACGGCATTCGAAGGGGAGCAAGACGGTGTAATGACTTTTATCGGATCGAAG
ACGGAGACTGCTCTCCTGGGATTCGCGCGTACATATCTCGGCCTAGGGTCGCTTAGCGAGGCGCGGGACAATGCA
AATCTTGCCCAGATGGTGCCATTCGACTCAGGACGCAAGTGTATGGCAGTGGTCGTCAAGATGGAAAATGGTAAA
TACAGAATGCTGGTCAAAGGTGCATCCGAGATCCTGGTGGCGAGATCCACTCGAATTGTTCACAACGCTACGCAG
GACTTGGCAGAAGGGCCTATGTCGGATCAGGACCGGTCTAACCTGGACAATTTGATCAACCGTTATGCATCTCGT
TCGTTGCGAACTATTGGTCTGGTGTACCGGGACTTCGATCAATGGCCACCCCGCGGAGCACCCACGCAGGAGGAG
GACCGTTCGCTCGCTGTTTTCGATGCAGTTTTCAAGGATATGATCTTGCTAGGCGTCTTCGGTATCCAAGATCCC
TTGCGACCGGGTGTGACCGAGTCTGTCCACCAGTGTCAGCGCGCAGGTGTCTTTGTGCGTATGGTGACTGGCGAT
AACATCATGACTGCTAAAGCTATCGCCCAAGAATGTGGCATCTTCACCCCTGGAGGTATTGCCATTGAGGGCCCC
AAGTTCCGTCAGCTGAGCAGCCGCCAAATGACGCAGATCATCCCGCGGCTACAGGTTTTGGCCAGGTCAAGCCCC
GACGACAAGAAGATCCTGGTTAATCAACTCAAAAAGCTGGGTGAAACGGTGGCTGTGACAGGCGACGGTACAAAT
GATGCACAAGCTCTCAAGACGGCCGATGTTGGCTTTTCCATGGGAATCTCTGGCACTGAAGTTGCTAAAGAAGCA
TCCGATATCATCCTCATGGACGACAACTTCACCTCGATTATTAAGGCTATGGCTTGGGGTAGGACAGTCAACGAT
GCTGTCAAGAAATTCCTTCAGGTATGGCTTCCTTATATGTTCCTGTGTTTCGCAAGCAAAACTAACCGAGCTGTA
GTTCCAACTTACTGTCAACGTTACTGCCGTGGTCCTCACTTTCGTTTCCGCAGTAGCAAGTGGAGATGAGGAATC
TGTCCTGACAGCAGTTCAGCTTCTTTGGGTCAACCTTATCATGGACACCTTTGCGGCCCTTGCCTTGGCTACGGA
TCCTCCCTCGCCTCATGTTCTCGACCGTCGACCTGACCCTAAATCGGCGCCCCTGATCAATCTGACTATGTGGAA
GATGATTATCGGACAAAGCATCTACCAGTTAGTCGTCACGCTGGTTCTGAACTTCGCAGGGAAATCGATCTTTCA
CTACAAAACGGCAGACGACCTCGATCGGCTTGAGACCATGGTGTTCAATACGTTTGTGTGGATGCAGATCTTCAA
CCAGTGGAATTGTCGCAGACTCGATAACAACTTCAATATCTTTGAGGGCATGTGGCGAAACTTCTGGTTCATGGG
GATTCAGTTGATCATCATTGGAGGTCAAATTCTCATCATCTTCGTTGGTGGACAGGCTTTCTCTGTCAAGCGACT
CGATGGAGCTCAGTGGGGTGTTTCACTGGTTCTGGGCGTGATCTCTCTGCCGGTAGGCGTGATCATTCGTTTGAT
ACCTGATGAGTTTATTAGCAGACTCATTCCTCGGTTCTGGCAGCGCAAGAAGGGCCCCGAACTTCTGGTGTCCGA
CGAGGACCGGCGGTTTGAGTGGAACCCTGCGCTCGAGGAGATCCGTGATCAGTTGAAGTTCCTCAAGACGGTCCG
CGGAGGTCGGCTGAGGCACCTCAAGCACAAGTTGCAACATCCAGAAGAACTCCTCCCAAGATCACGAAGCGGGTC
ACGGTCCAGAGAAAACTCGATTCCCGGTACTCCTGTTGGCGAACACAGCGACAGTACCCCGACGCAGCCACCGAC
TCCTGATTCGCGGTCTAGACGTCGCACTCGGTCCCGCTCGAATTCAGCATTCGGGCCTGCTGCTGCTATGGCCGG
TGTGGTTGCGGGTAGTATTGCAGGCTGGTCTCCAATCGAGCGGGCACCAGGCGACGGAGAAGCTTTCAAGGTTCA
GACGGACAGCCCTCATGGGGGTCTGGATAAGCAGAAGGGCATTGAAATCCACCCCGATACTGCCGCTGATGACCG
TATTCTGGGCGATTACCAGACCACTTCAAAGACTCCTCCCAGCCAAAACCCAGGGCTCCTCCCGTTCTTTGAATA
CGCACCGCCTGAGCGTGCTCCCTCCCATCGGAGCCAGAGATCCACTTCTCGCTTGTCGCGATCCAGCCAAAGCCA
GGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail