Fungal Genomics

at Utrecht University

General Properties

Protein IDAni_SJS72_1|g5971.t1
Gene name
Locationscaffold_043:22444..23606
Strand+
Gene length (bp)1162
Transcript length (bp)996
Coding sequence length (bp)996
Protein length (aa) 332

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12271 Chs7 Chitin synthase export chaperone 3.0E-126 2 285

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.5

Transmembrane Domains

Domain # Start End Length
1 49 71 22
2 84 106 22
3 116 138 22
4 150 172 22
5 187 209 22
6 216 238 22
7 253 272 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ani_SJS72_1|g5971.t1
MGFGDFDSLCEKAPLPLCSLVGPPSSISGSTGIIPNCYARNIELANTIIFEGASCFLHIIALGMTVIMILHIRSK
FTAVGRKEIITFFYIYMALTLCSLILDAGVVPPGSSPFPYFAAVQNGLASALCTSLLINGFVGFQLYEDGTILSV
WLLRLSSAAMFVISFLVSLATFKAWGGLGPTNTVGMFVVLYILNAICIAVYLVMSLLLVMNTLEDRWPLGHIAFG
LVVFICGQVLLYAFSDTICDSVQHYMDGLFFATFCNLLAVMMVYKFWDYITKEDLEFSVGIKPNTWEVKELLPDE
DRRQTGYYADANSEYAGSMYHHRTSTYHGHN*
Coding >Ani_SJS72_1|g5971.t1
ATGGGTTTTGGCGATTTCGATTCGTTATGCGAGAAGGCTCCTTTGCCGCTCTGCTCCCTGGTGGGTCCACCATCT
TCAATATCGGGCTCGACGGGCATCATACCAAATTGTTATGCGCGAAACATTGAACTGGCCAATACCATCATCTTC
GAAGGGGCCTCCTGCTTCCTTCACATCATCGCGCTGGGGATGACCGTGATTATGATTTTGCATATCCGGTCCAAG
TTCACTGCTGTTGGTCGCAAAGAAATTATTACGTTCTTTTACATTTACATGGCTCTGACCCTATGTTCCCTGATC
CTTGATGCAGGGGTTGTTCCACCTGGAAGTAGCCCATTTCCATACTTTGCAGCAGTGCAAAATGGGCTGGCGTCG
GCGCTATGCACATCCCTGCTCATCAACGGATTTGTTGGTTTCCAACTCTACGAGGACGGAACAATCCTTTCAGTC
TGGCTTCTTCGGCTTTCTTCCGCGGCGATGTTTGTCATCTCTTTCCTTGTCTCTCTCGCAACCTTCAAGGCATGG
GGAGGCCTGGGTCCCACTAACACAGTTGGCATGTTTGTCGTTCTGTATATCCTGAACGCCATCTGCATCGCCGTG
TATCTGGTGATGTCACTGTTACTGGTAATGAACACCCTTGAGGACCGCTGGCCTCTCGGTCACATCGCTTTTGGT
CTTGTGGTCTTCATCTGTGGTCAGGTGCTCCTTTACGCATTCAGTGACACCATCTGCGATAGCGTGCAACATTAC
ATGGACGGTCTTTTCTTCGCCACGTTCTGTAACCTCTTGGCGGTCATGATGGTGTACAAGTTCTGGGACTACATT
ACGAAAGAAGATCTCGAGTTTTCCGTCGGGATCAAGCCCAACACCTGGGAGGTCAAGGAACTCCTCCCGGATGAG
GATCGCCGGCAGACAGGTTACTACGCTGATGCAAATTCGGAGTATGCCGGGAGCATGTATCATCATCGGACATCG
ACCTATCACGGCCATAACTAG
Transcript >Ani_SJS72_1|g5971.t1
ATGGGTTTTGGCGATTTCGATTCGTTATGCGAGAAGGCTCCTTTGCCGCTCTGCTCCCTGGTGGGTCCACCATCT
TCAATATCGGGCTCGACGGGCATCATACCAAATTGTTATGCGCGAAACATTGAACTGGCCAATACCATCATCTTC
GAAGGGGCCTCCTGCTTCCTTCACATCATCGCGCTGGGGATGACCGTGATTATGATTTTGCATATCCGGTCCAAG
TTCACTGCTGTTGGTCGCAAAGAAATTATTACGTTCTTTTACATTTACATGGCTCTGACCCTATGTTCCCTGATC
CTTGATGCAGGGGTTGTTCCACCTGGAAGTAGCCCATTTCCATACTTTGCAGCAGTGCAAAATGGGCTGGCGTCG
GCGCTATGCACATCCCTGCTCATCAACGGATTTGTTGGTTTCCAACTCTACGAGGACGGAACAATCCTTTCAGTC
TGGCTTCTTCGGCTTTCTTCCGCGGCGATGTTTGTCATCTCTTTCCTTGTCTCTCTCGCAACCTTCAAGGCATGG
GGAGGCCTGGGTCCCACTAACACAGTTGGCATGTTTGTCGTTCTGTATATCCTGAACGCCATCTGCATCGCCGTG
TATCTGGTGATGTCACTGTTACTGGTAATGAACACCCTTGAGGACCGCTGGCCTCTCGGTCACATCGCTTTTGGT
CTTGTGGTCTTCATCTGTGGTCAGGTGCTCCTTTACGCATTCAGTGACACCATCTGCGATAGCGTGCAACATTAC
ATGGACGGTCTTTTCTTCGCCACGTTCTGTAACCTCTTGGCGGTCATGATGGTGTACAAGTTCTGGGACTACATT
ACGAAAGAAGATCTCGAGTTTTCCGTCGGGATCAAGCCCAACACCTGGGAGGTCAAGGAACTCCTCCCGGATGAG
GATCGCCGGCAGACAGGTTACTACGCTGATGCAAATTCGGAGTATGCCGGGAGCATGTATCATCATCGGACATCG
ACCTATCACGGCCATAACTAG
Gene >Ani_SJS72_1|g5971.t1
ATGGGTTTTGGCGATTTCGATTCGTTATGCGAGAAGGCTCCTTTGCCGCTCTGCTCCCTGGTGGGTCCACCATCT
TCAATATCGGGCTCGACGGGCATCATACCAAATTGTTATGCGCGAAACATTGAACTGGCCAATACCATCATCTTC
GAAGGGGCCTCCTGCTTCCTTCACATCATCGCGCTGGGGATGACCGTGATTATGATTTTGCATATCCGGTCCAAG
TTCACTGCTGTTGGTAAGTGTCCTCACATTATGTCTCTATGTGTCGCGTTGCTGGAGTCAAGTGGCCCCCCGAGA
ACCGAACATCATTTACCAACATCATGTTATCACAGGTCGCAAAGAAATTATTACGTTCTTTTACATTTACATGGC
TCTGACCCTATGTTCCCTGATCCTTGATGCAGGGGTTGTTCCACCTGGAAGTAGCCCATTTCCATACTTTGCAGC
AGTGCAAAATGGGCTGGCGTCGGCGCTATGCACATCCCTGCTCATCAACGGATTTGTTGGTTTCCAACTCTACGA
GGACGGAACAATCCTTTCAGTCTGGCTTCTTCGGCTTTCTTCCGCGGCGATGTTTGTCATCTCTTTCCTTGTCTC
TCTCGCAACCTTCAAGGCATGGGGAGGCCTGGGTCCCACTAACACAGTTGGCATGTTTGTCGTTCTGTATATCCT
GAACGCCATCTGCATCGCCGTGTATCTGGTGATGTCACTGTTACTGGTAATGAACACCCTTGAGGACCGCTGGCC
TCTCGGTCACATCGCTTTTGGTCTTGTGGTCTTCATCTGTGGTCAGGTGCTCCTTTACGCATTCAGTGACACCAT
CTGCGATAGCGTGCAACATTACATGGACGGTCTTTTCTTCGCCACGTTCTGTAACCTCTTGGCGGTCATGATGGT
GTACAAGGTACGTATTTCCATCATTGTTCCAGAAGACTAAAACCCTGCAAGGTTTCTGACACGCACCCCTGTCTA
GTTCTGGGACTACATTACGAAAGAAGATCTCGAGTTTTCCGTCGGGATCAAGCCCAACACCTGGGAGGTCAAGGA
ACTCCTCCCGGATGAGGATCGCCGGCAGACAGGTTACTACGCTGATGCAAATTCGGAGTATGCCGGGAGCATGTA
TCATCATCGGACATCGACCTATCACGGCCATAACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail